BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H03 (564 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 24 1.0 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 1.8 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.6 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 23.8 bits (49), Expect = 1.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 433 TGAWYRFRYSIAHQIIHGNPSDTILRYCSIRMIFK 537 +G Y+ Y + HQI H TI C++ +FK Sbjct: 100 SGVVYKIGYWL-HQICHICELHTIFLVCNVLTVFK 133 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 1.8 Identities = 15/68 (22%), Positives = 29/68 (42%) Frame = +2 Query: 167 SIARITRGVYANPEDAAIAKGKVKFDDQRVERCRRAHLNDLENIPAFWILGALYVTTGPA 346 +I I ++A K K + D+Q ++ C R H + A +L + G Sbjct: 203 TINNILENLWAKKLIVVKDKKKSRSDEQTIDICMRCHDQLCDMCGAINMLFGFPIIIGCL 262 Query: 347 VAWATLLF 370 + + T++F Sbjct: 263 IQFNTIVF 270 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.6 bits (41), Expect = 9.6 Identities = 5/18 (27%), Positives = 10/18 (55%) Frame = +1 Query: 343 SSCVGHIIIPFIHCWKNC 396 ++C + ++CWK C Sbjct: 717 ANCSPDLYAVMLNCWKEC 734 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,241 Number of Sequences: 336 Number of extensions: 2734 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -