BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H02 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 26 0.80 AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. 23 7.5 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 26.2 bits (55), Expect = 0.80 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 8/54 (14%) Frame = +3 Query: 132 VATKLEEMHVHQVYE--------QIAGHFSTTRHKPWPKVVEFMRQVSTGAVVI 269 V +LEE+ ++V+E I +F T + K WP V ++ STG V+ Sbjct: 191 VDKRLEELGANRVFELGLGDDDANIEDYFITWKEKFWPTVCDYFGIESTGEDVL 244 >AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. Length = 103 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 81 TLCDS-VERTSTDDIDDEVA 137 +LC S V R TDD DD+ A Sbjct: 64 SLCGSPVSRAQTDDDDDDAA 83 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 627,317 Number of Sequences: 2352 Number of extensions: 12587 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -