BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G20 (608 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0379 + 43177978-43178572,43178643-43178674 34 0.10 01_06_1092 + 34469732-34470118 33 0.18 01_01_0010 - 62670-62783,62877-63020,63339-63431,63665-63779,639... 31 0.54 03_05_0936 - 28955486-28955683,28956320-28956424,28956550-289566... 29 3.8 08_01_1007 - 10201181-10201298,10202180-10202484,10202577-102027... 28 6.7 07_01_0783 + 6068229-6068503,6069159-6069269,6069806-6070150,607... 28 6.7 12_01_0415 + 3292576-3293727 27 8.8 09_01_0053 + 873918-874411,875255-875492,875682-875702 27 8.8 >01_07_0379 + 43177978-43178572,43178643-43178674 Length = 208 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 221 LSYCCVSCPFRSKIH-TGSRTSYHLTRRRDYRFFRKYITA 105 L Y C C FR+ T S+T +HL R +YR++ Y+ A Sbjct: 157 LFYSCACCAFRNTATATSSKTIFHLHPRWEYRWYLLYLCA 196 >01_06_1092 + 34469732-34470118 Length = 128 Score = 33.1 bits (72), Expect = 0.18 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +2 Query: 386 GAKLASLHPCICTREKDPVCGSDGVTY 466 G A L P C R DPVCG+DGVTY Sbjct: 49 GGSEAQLCPVRCFRP-DPVCGADGVTY 74 >01_01_0010 - 62670-62783,62877-63020,63339-63431,63665-63779, 63902-64152,64248-64431,64694-64950 Length = 385 Score = 31.5 bits (68), Expect = 0.54 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = -3 Query: 456 PSLPQTGSFSRVHIHGCKLASLAPWHSPSCSIFRDGIIFWVHSSEHLLA*VFPL 295 PS FS V I+ C L L +S S +DG++F+ + H LA + PL Sbjct: 190 PSTYHRYRFSAVPIYECTLQGLQAAYSGSTPYVKDGLLFY-NKHAHYLAGITPL 242 >03_05_0936 - 28955486-28955683,28956320-28956424,28956550-28956693, 28957078-28957356,28957480-28957587,28958288-28958567, 28958724-28960029,28961301-28962342 Length = 1153 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 158 YHLTRRRDYRFFRKYITAVAELLPSIL 78 YHL R DY ++R+++ V ELL + L Sbjct: 864 YHLLRLYDYFYYREHLLIVCELLKANL 890 >08_01_1007 - 10201181-10201298,10202180-10202484,10202577-10202726, 10202954-10202956 Length = 191 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 6/39 (15%) Frame = +2 Query: 308 YANKCS--LECTQKIIPSL----KMEHDGECQGAKLASL 406 + NKC +EC QK P L K+ DG CQGA L L Sbjct: 125 FENKCKELIEC-QKASPQLLLTAKVTQDGSCQGAILDQL 162 >07_01_0783 + 6068229-6068503,6069159-6069269,6069806-6070150, 6071030-6071211,6071331-6071422,6071505-6071835, 6071960-6072170,6072551-6072665,6073677-6073838, 6073938-6074610,6074766-6074972,6075134-6076254 Length = 1274 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -1 Query: 584 CSNGFSFPPPTLCYYRKDRCVR-CSSLVWTVTRIL 483 CS G S P + Y R RC++ CS L + R+L Sbjct: 1024 CSGGLSPVAPGILYLRIFRCIKDCSILAEDILRLL 1058 >12_01_0415 + 3292576-3293727 Length = 383 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 Query: 108 GGGRAVTEYISAAAIRRIPSLFILC 34 GGG E +S A IRR+ FILC Sbjct: 38 GGGGGGEEILSVAWIRRLLEAFILC 62 >09_01_0053 + 873918-874411,875255-875492,875682-875702 Length = 250 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 237 HARWASPATVPWSMPPSVALTEKLTPT 317 HA+W+ ATV + P + + E+L T Sbjct: 192 HAKWSPAATVTFMYEPEIRINEELMET 218 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,241,214 Number of Sequences: 37544 Number of extensions: 445620 Number of successful extensions: 1224 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1224 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -