BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G18 (371 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4UH38 Cluster: Putative uncharacterized protein; n=2; ... 32 2.9 UniRef50_A0E3L2 Cluster: Chromosome undetermined scaffold_77, wh... 32 3.8 UniRef50_UPI00006DA6CA Cluster: hypothetical protein BcenP_01004... 31 5.0 UniRef50_Q2HHU8 Cluster: Putative uncharacterized protein; n=1; ... 31 6.7 UniRef50_Q23CZ2 Cluster: Putative uncharacterized protein; n=1; ... 31 8.8 UniRef50_A0DPG8 Cluster: Chromosome undetermined scaffold_59, wh... 31 8.8 >UniRef50_Q4UH38 Cluster: Putative uncharacterized protein; n=2; Theileria|Rep: Putative uncharacterized protein - Theileria annulata Length = 718 Score = 32.3 bits (70), Expect = 2.9 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +3 Query: 6 LTNPITLTKPNYPNQANYPEQANYP*PTQLP 98 LTN LT NYP ANYP+ NYP T P Sbjct: 323 LTNYPQLT--NYPQLANYPQWTNYPQLTNYP 351 >UniRef50_A0E3L2 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 344 Score = 31.9 bits (69), Expect = 3.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 27 TKPNYPNQANYPEQANYP*PTQLP 98 T+P YP Q YP QA YP T P Sbjct: 46 TQPGYPPQPGYPPQAGYPPQTGYP 69 Score = 31.1 bits (67), Expect = 6.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 30 KPNYPNQANYPEQANYP 80 +PNYP Q YP Q NYP Sbjct: 17 QPNYPPQPGYPPQPNYP 33 >UniRef50_UPI00006DA6CA Cluster: hypothetical protein BcenP_01004534; n=1; Burkholderia cenocepacia PC184|Rep: hypothetical protein BcenP_01004534 - Burkholderia cenocepacia PC184 Length = 71 Score = 31.5 bits (68), Expect = 5.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 15 PITLTKPNYPNQANYPEQANYP 80 PI KPN PNQ N P Q N P Sbjct: 24 PIKPIKPNQPNQPNQPNQPNQP 45 >UniRef50_Q2HHU8 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 432 Score = 31.1 bits (67), Expect = 6.7 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 9 TNPITLTKPNYPNQANYPEQANYP-*PTQLP*ASQVSLSKPS 131 T P T+P PNQ P Q P PTQ AS ++KPS Sbjct: 291 TQPTQPTQPAQPNQPTQPTQPTQPTQPTQPTQASSQGVNKPS 332 >UniRef50_Q23CZ2 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 545 Score = 30.7 bits (66), Expect = 8.8 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 54 NYPEQANYP*PTQLP*ASQVSLSKPS*P 137 NYP+Q NY P P A Q +LS+P P Sbjct: 294 NYPQQVNYQMPPPPPPAQQNNLSQPQNP 321 >UniRef50_A0DPG8 Cluster: Chromosome undetermined scaffold_59, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_59, whole genome shotgun sequence - Paramecium tetraurelia Length = 976 Score = 30.7 bits (66), Expect = 8.8 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +3 Query: 15 PITLTKPNYPNQANYPEQANYP*PTQLP*ASQVSLSKPS*P 137 PIT PN PN N P N P +P S S+ KP P Sbjct: 89 PIT-NMPNMPNVPNMPNMPNMPNMPPIPSISNFSIPKPIPP 128 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,533,313 Number of Sequences: 1657284 Number of extensions: 2125068 Number of successful extensions: 6236 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6156 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 13594373344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -