BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G17 (563 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5KBB5 Cluster: Putative uncharacterized protein; n=1; ... 35 1.1 UniRef50_A0CJ73 Cluster: Chromosome undetermined scaffold_194, w... 35 1.1 UniRef50_Q4H377 Cluster: Mitogen-activated protein kinase kinase... 34 2.6 UniRef50_Q236N4 Cluster: Putative uncharacterized protein; n=1; ... 33 3.5 UniRef50_Q4Z3U4 Cluster: Putative uncharacterized protein; n=3; ... 33 6.1 UniRef50_Q7RQW4 Cluster: Capn7-related; n=4; Plasmodium (Vinckei... 32 8.1 UniRef50_A0BHE1 Cluster: Chromosome undetermined scaffold_108, w... 32 8.1 >UniRef50_A5KBB5 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 3973 Score = 35.1 bits (77), Expect = 1.1 Identities = 30/81 (37%), Positives = 39/81 (48%) Frame = +3 Query: 3 LVVRFYIKMYLENRNLVEEIGFNLKYRLHLELKCGLIEENIK*STRTWSVPLTIKWRSSI 182 L+ R Y KM NL EEIG N L L +IEEN S +PL + + Sbjct: 3319 LISRNYEKMKDLYNNLSEEIGKN-----KLLLMSKIIEENH--SYNVADMPLYVNFIFYK 3371 Query: 183 YYCVNHWYL*NKNLRETIIKK 245 Y CVN W NLRE+ +++ Sbjct: 3372 YSCVNTWNNLVHNLRESFLRE 3392 >UniRef50_A0CJ73 Cluster: Chromosome undetermined scaffold_194, whole genome shotgun sequence; n=10; cellular organisms|Rep: Chromosome undetermined scaffold_194, whole genome shotgun sequence - Paramecium tetraurelia Length = 1647 Score = 35.1 bits (77), Expect = 1.1 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 538 LRPCFKI-KVMEIFLNN*YNYRFVKIDLTEKIKYLEDQVIF 419 L CF I K+ +FLN+ YN ++VK+ T+K+K + + F Sbjct: 1034 LSQCFPIAKISIVFLNSTYNTQYVKLSYTKKVKLNQQDIHF 1074 >UniRef50_Q4H377 Cluster: Mitogen-activated protein kinase kinase; n=1; Ciona intestinalis|Rep: Mitogen-activated protein kinase kinase - Ciona intestinalis (Transparent sea squirt) Length = 1093 Score = 33.9 bits (74), Expect = 2.6 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 392 AANYLRIPRLIPCPKRFR*VLYNCWFTGLKMRP 294 A N L +P CPK F+ +L CW + +MRP Sbjct: 279 AVNKLTLPIPSTCPKEFKDLLERCWSSNSQMRP 311 >UniRef50_Q236N4 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1064 Score = 33.5 bits (73), Expect = 3.5 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = -2 Query: 166 FIVSGTDHVLVDYLMFSSINPHFNSKCSLYFRLKPISSTKFLFSKYILI*NL 11 +I++ D + L F ++ PH +C++YF I S + FS+ + NL Sbjct: 582 YIINQNDPQDIQQLQFITLTPHEKQECTIYFPKNSIDSQNYDFSQVQIANNL 633 >UniRef50_Q4Z3U4 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 1629 Score = 32.7 bits (71), Expect = 6.1 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 2/80 (2%) Frame = +3 Query: 18 YIKMYLENRNLVEEIGFNLKYRLHLELK-CGLIEENIK-*STRTWSVPLTIKWRSSIYYC 191 Y+K++ EN N++ GFN+ Y EL CG+ NI + + K +S C Sbjct: 184 YVKLFTENNNILNNDGFNM-YEQDKELNFCGIFNYNISHDEVNSGNYNRNAKQVNSNNIC 242 Query: 192 VNHWYL*NKNLRETIIKKNR 251 +N + NK +K + Sbjct: 243 INSSIINNKKKELNYSRKQK 262 >UniRef50_Q7RQW4 Cluster: Capn7-related; n=4; Plasmodium (Vinckeia)|Rep: Capn7-related - Plasmodium yoelii yoelii Length = 1999 Score = 32.3 bits (70), Expect = 8.1 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 2/80 (2%) Frame = +3 Query: 18 YIKMYLENRNLVEEIGFNLKYRLHLELK-CGLIEENIK-*STRTWSVPLTIKWRSSIYYC 191 Y+K++ EN N + GFN+ Y EL CG+ N+ + + + +K +S C Sbjct: 347 YVKLFTENNNRLNNFGFNM-YEQDRELNFCGIFNYNLSHDEVDSGNHNMNVKQVNSNKIC 405 Query: 192 VNHWYL*NKNLRETIIKKNR 251 VN + N+ +K + Sbjct: 406 VNSSIINNRKKELNYSRKQK 425 >UniRef50_A0BHE1 Cluster: Chromosome undetermined scaffold_108, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_108, whole genome shotgun sequence - Paramecium tetraurelia Length = 191 Score = 32.3 bits (70), Expect = 8.1 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +3 Query: 12 RFYIKMYLENRNLVEEIGFNLKYRLHLELKCGLIEENIK*STRTWSVPLTIKWRSSIYYC 191 R+YIK ++ +LVE I F L++ +L + + + I + RT PL I + S+ C Sbjct: 99 RYYIKNFMNKLHLVEVIYFGLQFVYNLFILFYIFKMPINQNYRTKLAPLIILFIESLINC 158 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,040,480 Number of Sequences: 1657284 Number of extensions: 9445772 Number of successful extensions: 18073 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18065 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37904934977 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -