BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G17 (563 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U22322-1|AAC50116.1| 505|Homo sapiens Rak protein. 29 8.5 U00803-1|AAA18284.1| 505|Homo sapiens SRC-like tyrosine kinase ... 29 8.5 BC012916-1|AAH12916.1| 505|Homo sapiens fyn-related kinase prot... 29 8.5 AL357141-2|CAI16469.1| 505|Homo sapiens fyn-related kinase prot... 29 8.5 AL121963-8|CAB87592.2| 505|Homo sapiens fyn-related kinase prot... 29 8.5 >U22322-1|AAC50116.1| 505|Homo sapiens Rak protein. Length = 505 Score = 29.5 bits (63), Expect = 8.5 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 392 AANYLRIPRLIPCPKRFR*VLYNCWFTGLKMRPPPSLFRY 273 A NY R+P+ CP++F ++ CW K RP R+ Sbjct: 447 AQNY-RLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRW 485 >U00803-1|AAA18284.1| 505|Homo sapiens SRC-like tyrosine kinase protein. Length = 505 Score = 29.5 bits (63), Expect = 8.5 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 392 AANYLRIPRLIPCPKRFR*VLYNCWFTGLKMRPPPSLFRY 273 A NY R+P+ CP++F ++ CW K RP R+ Sbjct: 447 AQNY-RLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRW 485 >BC012916-1|AAH12916.1| 505|Homo sapiens fyn-related kinase protein. Length = 505 Score = 29.5 bits (63), Expect = 8.5 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 392 AANYLRIPRLIPCPKRFR*VLYNCWFTGLKMRPPPSLFRY 273 A NY R+P+ CP++F ++ CW K RP R+ Sbjct: 447 AQNY-RLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRW 485 >AL357141-2|CAI16469.1| 505|Homo sapiens fyn-related kinase protein. Length = 505 Score = 29.5 bits (63), Expect = 8.5 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 392 AANYLRIPRLIPCPKRFR*VLYNCWFTGLKMRPPPSLFRY 273 A NY R+P+ CP++F ++ CW K RP R+ Sbjct: 447 AQNY-RLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRW 485 >AL121963-8|CAB87592.2| 505|Homo sapiens fyn-related kinase protein. Length = 505 Score = 29.5 bits (63), Expect = 8.5 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 392 AANYLRIPRLIPCPKRFR*VLYNCWFTGLKMRPPPSLFRY 273 A NY R+P+ CP++F ++ CW K RP R+ Sbjct: 447 AQNY-RLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRW 485 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,129,795 Number of Sequences: 237096 Number of extensions: 1323632 Number of successful extensions: 5753 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5753 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5703349406 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -