BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G17 (563 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 4.9 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 6.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 8.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 8.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.6 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -1 Query: 377 RIPRLIPCPKRFR*VLYNCWFTGLKMRP 294 R+P + CP+ ++ +CW RP Sbjct: 856 RLPAPMDCPEAIYQLMLDCWQKERTHRP 883 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 283 NDGGGRILSP 312 NDG G ILSP Sbjct: 358 NDGNGNILSP 367 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 240 KKNRL**RRTNVSEQ*RGRSHLEPRKPAIVEY 335 ++ RL RR + +Q R R H +K I+EY Sbjct: 32 QEERLRRRREWMIQQEREREHERLKKKMILEY 63 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 240 KKNRL**RRTNVSEQ*RGRSHLEPRKPAIVEY 335 ++ RL RR + +Q R R H +K I+EY Sbjct: 32 QEERLRRRREWMIQQEREREHERLKKKMILEY 63 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 240 KKNRL**RRTNVSEQ*RGRSHLEPRKPAIVEY 335 ++ RL RR + +Q R R H +K I+EY Sbjct: 32 QEERLRRRREWMIQQEREREHERLKKKMILEY 63 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 240 KKNRL**RRTNVSEQ*RGRSHLEPRKPAIVEY 335 ++ RL RR + +Q R R H +K I+EY Sbjct: 32 QEERLRRRREWMIQQEREREHERLKKKMILEY 63 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 240 KKNRL**RRTNVSEQ*RGRSHLEPRKPAIVEY 335 ++ RL RR + +Q R R H +K I+EY Sbjct: 32 QEERLRRRREWMIQQEREREHERLKKKMILEY 63 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 240 KKNRL**RRTNVSEQ*RGRSHLEPRKPAIVEY 335 ++ RL RR + +Q R R H +K I+EY Sbjct: 32 QEERLRRRREWMIQQEREREHERLKKKMILEY 63 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 240 KKNRL**RRTNVSEQ*RGRSHLEPRKPAIVEY 335 ++ RL RR + +Q R R H +K I+EY Sbjct: 32 QEERLRRRREWMIQQEREREHERLKKKMILEY 63 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 240 KKNRL**RRTNVSEQ*RGRSHLEPRKPAIVEY 335 ++ RL RR + +Q R R H +K I+EY Sbjct: 32 QEERLRRRREWMIQQEREREHERLKKKMILEY 63 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,546 Number of Sequences: 438 Number of extensions: 3156 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -