BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G14 (681 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031633-16|CAA21028.1| 374|Caenorhabditis elegans Hypothetical... 28 5.4 AF022970-1|AAB69895.1| 142|Caenorhabditis elegans Hypothetical ... 28 5.4 AF016678-7|AAB66154.3| 340|Caenorhabditis elegans Serpentine re... 28 5.4 Z81132-9|CAB03438.1| 320|Caenorhabditis elegans Hypothetical pr... 28 7.1 U58746-2|AAB00622.2| 283|Caenorhabditis elegans Hypothetical pr... 27 9.4 >AL031633-16|CAA21028.1| 374|Caenorhabditis elegans Hypothetical protein Y39A1A.16 protein. Length = 374 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 264 NHFQFHHVDVFRNPLFFQ 211 NHF++H +D F PLF+Q Sbjct: 70 NHFEYH-IDKFHQPLFYQ 86 >AF022970-1|AAB69895.1| 142|Caenorhabditis elegans Hypothetical protein F13A2.1 protein. Length = 142 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 135 MYHNGIPYPVRPNHFHL-DHPEYLGELEKIKDYERRLRDGIEN 260 M NG P+P HFH+ D + L ELE +D E R + +N Sbjct: 29 MVLNGTPFPDILRHFHVSDFSKELAELEIKQDAEFRKKSLWQN 71 >AF016678-7|AAB66154.3| 340|Caenorhabditis elegans Serpentine receptor, class i protein45 protein. Length = 340 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 132 YMYHNGIPYPVRPNHFHLDHPEYLGELEKIKDY 230 + YH GI + P +L +PE+ E +K++ Sbjct: 165 FWYHAGIAEDLLPGFVNLTYPEFKAEFSNLKNF 197 >Z81132-9|CAB03438.1| 320|Caenorhabditis elegans Hypothetical protein T26E4.11 protein. Length = 320 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 158 IWYTVMIHVSKIVAFVYDVTTKFTDFTKS 72 +W V + + + V Y + TK DFT S Sbjct: 99 VWLAVSLAILRAVVIKYPINTKIQDFTSS 127 >U58746-2|AAB00622.2| 283|Caenorhabditis elegans Hypothetical protein R05G6.7 protein. Length = 283 Score = 27.5 bits (58), Expect = 9.4 Identities = 8/21 (38%), Positives = 17/21 (80%) Frame = +3 Query: 75 FGEIGELSGNVVNEGYNFGYM 137 F ++G+ + ++ N+GYNFG++ Sbjct: 6 FADLGKSAKDLFNKGYNFGFL 26 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,170,933 Number of Sequences: 27780 Number of extensions: 324202 Number of successful extensions: 940 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -