BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G11 (294 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51536| Best HMM Match : Trypsin (HMM E-Value=0) 46 5e-06 SB_43527| Best HMM Match : Trypsin (HMM E-Value=0) 45 1e-05 SB_33085| Best HMM Match : Trypsin (HMM E-Value=0) 42 1e-04 SB_52206| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_58527| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) 38 0.002 SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) 36 0.006 SB_31648| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.010 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.010 SB_31846| Best HMM Match : Trypsin (HMM E-Value=0) 34 0.017 SB_1442| Best HMM Match : SRCR (HMM E-Value=0) 34 0.023 SB_26911| Best HMM Match : Trypsin (HMM E-Value=0) 33 0.040 SB_28864| Best HMM Match : Trypsin (HMM E-Value=1.4e-40) 33 0.040 SB_36638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.053 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.069 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.12 SB_30267| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.12 SB_21521| Best HMM Match : Trypsin (HMM E-Value=1.7e-23) 31 0.12 SB_21033| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.12 SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.12 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.16 SB_10327| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.16 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 31 0.21 SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.21 SB_22567| Best HMM Match : Trypsin (HMM E-Value=6.6e-30) 31 0.21 SB_4906| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.21 SB_35844| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 30 0.37 SB_27293| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.37 SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23) 30 0.37 SB_53324| Best HMM Match : Trypsin (HMM E-Value=4.4e-08) 28 1.1 SB_8561| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.1 SB_17112| Best HMM Match : Trypsin (HMM E-Value=0) 27 2.0 SB_50335| Best HMM Match : Baculo_11_kDa (HMM E-Value=2.1) 27 2.6 SB_57150| Best HMM Match : ThiF (HMM E-Value=2.8e-35) 27 2.6 SB_11235| Best HMM Match : Trypsin (HMM E-Value=1.1e-08) 27 2.6 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_14819| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_11317| Best HMM Match : Trypsin (HMM E-Value=3e-08) 26 4.6 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.6 SB_36731| Best HMM Match : F5_F8_type_C (HMM E-Value=0.74) 26 4.6 SB_28897| Best HMM Match : Trypsin (HMM E-Value=0) 26 4.6 SB_24109| Best HMM Match : Trypsin (HMM E-Value=4.6e-06) 26 4.6 SB_19563| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.6 SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.6 SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.0 SB_55843| Best HMM Match : Aa_trans (HMM E-Value=0.00091) 26 6.0 SB_29746| Best HMM Match : Toxin_22 (HMM E-Value=3.8) 26 6.0 SB_41598| Best HMM Match : HLH (HMM E-Value=2.2) 26 6.0 SB_35167| Best HMM Match : zf-HIT (HMM E-Value=0.046) 26 6.0 SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 25 8.0 SB_5544| Best HMM Match : APG9 (HMM E-Value=7e-09) 25 8.0 SB_3824| Best HMM Match : Trypsin (HMM E-Value=2.8026e-45) 25 8.0 SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) 25 8.0 SB_7098| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.0 SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) 25 8.0 SB_453| Best HMM Match : Neur_chan_LBD (HMM E-Value=2.1e-08) 25 8.0 >SB_51536| Best HMM Match : Trypsin (HMM E-Value=0) Length = 347 Score = 46.0 bits (104), Expect = 5e-06 Identities = 21/44 (47%), Positives = 29/44 (65%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSL 247 +E+ I HP Y P++ +D+ALI+L Y D VRP+CLPSL Sbjct: 182 VERIILHPKYAPHNNHD-YDVALIKLASPLQYNDRVRPVCLPSL 224 >SB_43527| Best HMM Match : Trypsin (HMM E-Value=0) Length = 366 Score = 44.8 bits (101), Expect = 1e-05 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +2 Query: 134 HPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSL--DYTQ 259 HP Y P+ DIALIRL +TD+V+PICLPS DY Q Sbjct: 199 HPHYSPDSYDS--DIALIRLAQPVTFTDYVKPICLPSAASDYAQ 240 >SB_33085| Best HMM Match : Trypsin (HMM E-Value=0) Length = 537 Score = 41.5 bits (93), Expect = 1e-04 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDY 253 P+E+ I H +Y N V +D AL++L +T +V+P+CLP D+ Sbjct: 370 PVERIISHANYSYNTVD--YDYALLKLTRPLNFTQYVQPVCLPDSDF 414 >SB_52206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 786 Score = 41.5 bits (93), Expect = 1e-04 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDY 253 P+E+ I H +Y N V +D AL++L +T +V+P+CLP D+ Sbjct: 619 PVERIISHANYSYNTVD--YDYALLKLTRPLNFTQYVQPVCLPDSDF 663 >SB_58527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1659 Score = 37.5 bits (83), Expect = 0.002 Identities = 22/56 (39%), Positives = 28/56 (50%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPG 271 V I K IPH Y + + RHDIALI+L A + V +CLP +P G Sbjct: 1554 VQLKIAKIIPHKGYSRSHL--RHDIALIKLASPAKLSATVNTVCLPKQGSLAKPGG 1607 >SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 620 Score = 37.5 bits (83), Expect = 0.002 Identities = 20/49 (40%), Positives = 27/49 (55%) Frame = +2 Query: 107 TAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDY 253 T ++K I HP Y N+ + +DIALI L A + V P+CLP Y Sbjct: 546 TLNVKKVIAHPQY--NNPRLSNDIALIELASPAKLSSRVNPVCLPPHGY 592 >SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) Length = 718 Score = 37.5 bits (83), Expect = 0.002 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = +2 Query: 134 HPDYIPNDVQ--GRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 HP ++ V G +DIAL+ L ++D ++PICLP D T+ P G+ Sbjct: 65 HPGFVIGGVSHPGYYDIALLHLAKPIQFSDRIQPICLPQ-DDTEFPAGK 112 Score = 31.1 bits (67), Expect = 0.16 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 119 EKTIPHPDYIPN--DVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPP 268 EK HP Y D G +DIAL++L A + V +CLP ++ PP Sbjct: 613 EKLFIHPKYKLGGLDYTGDYDIALVKLKRPAVFYKRVHSVCLPEKSWS--PP 662 Score = 30.7 bits (66), Expect = 0.21 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +2 Query: 119 EKTIPHPDYIPNDV--QGRHDIALIRLMVTAPYTDFVRPICLPSL 247 +K HP + D+ G +D+ALI+L A + V +CLPS+ Sbjct: 324 DKLYIHPGLVVGDLISPGDYDVALIKLKRPAVFHKCVYSVCLPSV 368 Score = 30.3 bits (65), Expect = 0.28 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +2 Query: 134 HPDYIPNDV--QGRHDIALIRLMVTAPYTDFVRPICLPSL 247 HP + D+ G +D+ALI+L A + V +CLPS+ Sbjct: 446 HPGLVVGDLISPGDYDVALIKLKRPAVFHKRVHSVCLPSV 485 >SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) Length = 1007 Score = 35.9 bits (79), Expect = 0.006 Identities = 17/38 (44%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +2 Query: 134 HPDYIPNDVQGRHDIALIRLMVT-APYTDFVRPICLPS 244 HPDY ++++ +D+ALIRL +T VRP+CLP+ Sbjct: 521 HPDY--HEIKLTNDLALIRLRTPITTFTKHVRPVCLPT 556 >SB_31648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 656 Score = 35.1 bits (77), Expect = 0.010 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 + + I HP Y DV +D+AL++L A T FV +CLP+ Sbjct: 134 VRRIIKHPHY-SRDVPYDNDVALLQLSRPAFVTSFVNTVCLPA 175 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 35.1 bits (77), Expect = 0.010 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLPS 244 DIALIRL A T++VRP+CLP+ Sbjct: 1261 DIALIRLRWKANITEYVRPVCLPN 1284 >SB_31846| Best HMM Match : Trypsin (HMM E-Value=0) Length = 454 Score = 34.3 bits (75), Expect = 0.017 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPG 271 I K H DY Q +D+ALIRL A T +V+P+CL PPG Sbjct: 289 IAKIYLHADYNLYPHQYNNDVALIRLAKPAIRTRYVQPVCLAD-GTVSFPPG 339 >SB_1442| Best HMM Match : SRCR (HMM E-Value=0) Length = 2103 Score = 33.9 bits (74), Expect = 0.023 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 PIE + HP Y ND+ +DIAL++L + +V +CLP Sbjct: 1864 PIEGIVVHPSY--NDLD--YDIALLKLRQPITFNAYVSQVCLP 1902 >SB_26911| Best HMM Match : Trypsin (HMM E-Value=0) Length = 349 Score = 33.1 bits (72), Expect = 0.040 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K I HP Y V HDIAL++L +A + V +CLP Sbjct: 187 VSKVILHPSY-GKPVTLAHDIALLKLEKSATVNNNVHTVCLP 227 >SB_28864| Best HMM Match : Trypsin (HMM E-Value=1.4e-40) Length = 230 Score = 33.1 bits (72), Expect = 0.040 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 119 EKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICL 238 E TI + V +D+AL+RL A +T++V PICL Sbjct: 61 EATITVEGHRARHVPPDYDVALLRLATPAKFTNYVYPICL 100 >SB_36638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 32.7 bits (71), Expect = 0.053 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLD 250 +T P D++ D D+ALI+L A +++VRPICLP D Sbjct: 189 RTHPQFDHVLFDA----DLALIKLDGEAIISEYVRPICLPETD 227 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 32.3 bits (70), Expect = 0.069 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLP 241 +HD+ALIRL A ++ V P+CLP Sbjct: 400 KHDLALIRLAKPAAFSAKVSPVCLP 424 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 31.5 bits (68), Expect = 0.12 Identities = 20/50 (40%), Positives = 24/50 (48%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 +EK I HP Y V HDIALI+L+ A F S+D T P Sbjct: 736 VEKIIMHPGY-RKPVGLAHDIALIKLLKPANLNRFPTSTTSASVDQTNIP 784 >SB_30267| Best HMM Match : Trypsin (HMM E-Value=0) Length = 282 Score = 31.5 bits (68), Expect = 0.12 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS-LDYTQ 259 + I H Y N V +D+AL++L TDFV +CLP +D+ + Sbjct: 104 VAMVIKHYAY-GNPVPNANDVALLKLRDYPTKTDFVNTVCLPQYMDHVE 151 >SB_21521| Best HMM Match : Trypsin (HMM E-Value=1.7e-23) Length = 299 Score = 31.5 bits (68), Expect = 0.12 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLP 241 +HD+ALI+L A ++ V P+CLP Sbjct: 116 KHDLALIKLAKPATFSTKVSPVCLP 140 >SB_21033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 31.5 bits (68), Expect = 0.12 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +2 Query: 74 KGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 KG H I K HP + + HDIA++RL T V ICLPS Sbjct: 20 KGAHYREHDGKELTISKITYHPGF--SFATADHDIAILRLSAPVLLTSSVNTICLPS 74 >SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 31.5 bits (68), Expect = 0.12 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = +2 Query: 83 KDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 ++ + +T P+ H ++ + G +DIA+++L AP + P CLP L Y Q Sbjct: 349 RESSEGALTIPVTAIHMHTRFMTDGSYG-YDIAIMKLANPAPIGHTISPACLPGL-YDQV 406 Query: 263 PPG 271 G Sbjct: 407 TSG 409 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 31.1 bits (67), Expect = 0.16 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 119 EKTIPHPDYIPN--DVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPP 268 EK HP Y D G +DIAL++L A + V +CLP ++ PP Sbjct: 328 EKLFIHPKYKLGGLDYTGDYDIALVKLKRPAVFYKRVHSVCLPEKSWS--PP 377 Score = 30.3 bits (65), Expect = 0.28 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +2 Query: 134 HPDYIPNDV--QGRHDIALIRLMVTAPYTDFVRPICLPSL 247 HP + D+ G +D+ALI+L A + V +CLPS+ Sbjct: 69 HPGLVVGDLISPGDYDVALIKLKRPAVFHKRVHSVCLPSV 108 >SB_10327| Best HMM Match : Trypsin (HMM E-Value=0) Length = 865 Score = 31.1 bits (67), Expect = 0.16 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 158 VQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 V R+D+AL++L +D V ICLPS +QP Sbjct: 322 VHVRNDVALLKLSTYVQLSDKVGTICLPSQGARRQP 357 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 30.7 bits (66), Expect = 0.21 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H Y + +Q HDIALI+L A + V +CLP Sbjct: 21 VSKIVSHTSY-NSPLQYSHDIALIKLATPAIMGNGVGTVCLP 61 >SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1864 Score = 30.7 bits (66), Expect = 0.21 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 I+ HP Y N HD+A+++L A + V PIC+ + + Q Sbjct: 1313 IKAIFVHPQY--NSSSHEHDLAVLQLQQPAEFNSRVSPICIVANEEVQ 1358 >SB_22567| Best HMM Match : Trypsin (HMM E-Value=6.6e-30) Length = 249 Score = 30.7 bits (66), Expect = 0.21 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 ++K + +P + N+ R+DIAL+ L V P+CLP ++ + P G+ Sbjct: 17 VKKLVYNPGF--NERHYRNDIALLELERPVLTNPHVSPVCLPPVNAGKVPVGK 67 >SB_4906| Best HMM Match : Trypsin (HMM E-Value=0) Length = 530 Score = 30.7 bits (66), Expect = 0.21 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H Y + +Q HDIALI+L A + V +CLP Sbjct: 365 VSKIVSHTSY-NSPLQYSHDIALIKLATPAIMGNGVGTVCLP 405 >SB_35844| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 249 Score = 29.9 bits (64), Expect = 0.37 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPS 244 +DIAL++L A +FVR +CLP+ Sbjct: 137 YDIALLKLSRPAVINEFVRTVCLPA 161 >SB_27293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 29.9 bits (64), Expect = 0.37 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +2 Query: 134 HPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 H ++ D G +DIALI+L + VRPICLP Sbjct: 195 HRGFLTKDGWG-NDIALIQLKKRVRRSRLVRPICLP 229 >SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23) Length = 1178 Score = 29.9 bits (64), Expect = 0.37 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 32 LGEYNTTNNGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRH 172 L +Y+ PD K K HP + +K + HPD D+Q RH Sbjct: 1012 LYKYDKQARHPDLCKYDKQVRHPDMYK-YDKQVRHPDMCKYDIQVRH 1057 Score = 29.5 bits (63), Expect = 0.49 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +2 Query: 32 LGEYNTTNNGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRH 172 L +Y+ PD K K HP + +K + HPD D Q RH Sbjct: 976 LCKYDKQVRHPDMCKYDKQVRHPDM-CKYDKQVRHPDLYKYDKQARH 1021 Score = 27.1 bits (57), Expect = 2.6 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 38 EYNTTNNGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRH 172 +Y+ PD K K HP + +K + HPD D Q RH Sbjct: 942 KYDKQVRHPDLCKYDKQVRHPDLYK-YDKQVRHPDLCKYDKQVRH 985 Score = 25.8 bits (54), Expect = 6.0 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +2 Query: 38 EYNTTNNGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRH 172 +Y+ PD K HP + +K + HPD D+Q RH Sbjct: 1038 KYDKQVRHPDMCKYDIQVRHPDMYK-YDKQVRHPDMCKYDIQVRH 1081 >SB_53324| Best HMM Match : Trypsin (HMM E-Value=4.4e-08) Length = 182 Score = 28.3 bits (60), Expect = 1.1 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 134 HPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 HPDY + HD+AL++L A ++ V CLP Sbjct: 26 HPDYHKYTIFS-HDLALVKLSHPASISNTVNLACLP 60 >SB_8561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 28.3 bits (60), Expect = 1.1 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 5/66 (7%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYI--PN--DVQGRH-DIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 H +T P ++ I D I PN +Q + DIAL++L VR ICLP Sbjct: 68 HLQITDPTQQDILAKDIILHPNFKSLQTFYNDIALVKLRTRVKLGPSVRTICLPHKGEAL 127 Query: 260 QPPGRF 277 PG++ Sbjct: 128 LSPGKY 133 >SB_17112| Best HMM Match : Trypsin (HMM E-Value=0) Length = 636 Score = 27.5 bits (58), Expect = 2.0 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 116 IEKTIPHPDYI-PNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + + I HP Y P + +DIALI+L A +V CLP Sbjct: 427 VARIIVHPQYFEPTAIN--NDIALIKLNKPARLNKYVNLACLP 467 >SB_50335| Best HMM Match : Baculo_11_kDa (HMM E-Value=2.1) Length = 370 Score = 27.1 bits (57), Expect = 2.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 85 RLCTSRCYCSYRKNYSTSRLHPQRC 159 +LC S C+C + Y S++ + C Sbjct: 124 KLCPSHCFCLLSRGYRASKVMAKNC 148 >SB_57150| Best HMM Match : ThiF (HMM E-Value=2.8e-35) Length = 1026 Score = 27.1 bits (57), Expect = 2.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 50 TNNGPDCMKGTKDCAHPVVTAPIEKTIPHPDYI 148 T++G G K C HP+V P E T H D+I Sbjct: 592 TSSGQPFWSGPKRCPHPLVFDPREGT--HLDFI 622 >SB_11235| Best HMM Match : Trypsin (HMM E-Value=1.1e-08) Length = 235 Score = 27.1 bits (57), Expect = 2.6 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 + + I H ++ + R+D+ L+RL +D + ICLP+ Sbjct: 157 VSQVISHKEFSMGHL--RNDVTLLRLSAPVQLSDKIGTICLPA 197 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + + I HP+Y D+AL+RL A V ICLP Sbjct: 1405 VRQVIVHPNYRRQTTDS--DVALLRLSHPATLNKAVSLICLP 1444 >SB_14819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 26.6 bits (56), Expect = 3.5 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = -3 Query: 235 TDGPYKICIRCCYHQPNKRNVMSALHIVGDVIWMWNSFFYRSSNNGMCTVFGTFHAV 65 T G Y++ RC + + R S H +GD M++S F+ + GM FHA+ Sbjct: 103 TIGDYEMFDRCFHAIGDYRMFDSCFHAIGD-YGMFDSCFHAIGDYGMFD--SCFHAI 156 >SB_11317| Best HMM Match : Trypsin (HMM E-Value=3e-08) Length = 153 Score = 26.2 bits (55), Expect = 4.6 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +++ I H Y N V +DIA+I L A V CLP+ Q R W Sbjct: 97 VKRIIKHERY-SNPVNLANDIAVIELEEPARLNRAVNLACLPTQSNEIQEGKRCW 150 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 38 EYNTTNNGPDCMK-GTKDCAHPVVTA 112 E+NTTNNG CM+ C++ ++ A Sbjct: 4632 EWNTTNNGSRCMRMALYGCSYSLMIA 4657 >SB_36731| Best HMM Match : F5_F8_type_C (HMM E-Value=0.74) Length = 189 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 38 EYNTTNNGPDCMK-GTKDCAHPVVTA 112 E+NTTNNG CM+ C++ ++ A Sbjct: 75 EWNTTNNGSRCMRMALYGCSYSLMIA 100 >SB_28897| Best HMM Match : Trypsin (HMM E-Value=0) Length = 974 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLP 241 D+ALI+L T +VR +CLP Sbjct: 815 DVALIQLKGGVKLTAYVRTVCLP 837 >SB_24109| Best HMM Match : Trypsin (HMM E-Value=4.6e-06) Length = 151 Score = 26.2 bits (55), Expect = 4.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICL 238 DIAL+RL A + + V PICL Sbjct: 49 DIALVRLSEPAIFDENVSPICL 70 >SB_19563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 20 KNVRLGEYNTTNNGPDCMKGTKDC 91 K V L N + +GPDC+K DC Sbjct: 79 KEVALTLCNISYHGPDCLKVVLDC 102 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 26.2 bits (55), Expect = 4.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 74 KGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALI 187 KGT C +VT+ + ++ H D P V+G + LI Sbjct: 1415 KGTALCREGLVTSIVPSSVLHGDKSPEGVEGGGEPDLI 1452 >SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 898 Score = 25.8 bits (54), Expect = 6.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLPS 244 ++DIAL++L +D V +CLPS Sbjct: 119 KNDIALLQLHEPVKASDKVNTVCLPS 144 >SB_55843| Best HMM Match : Aa_trans (HMM E-Value=0.00091) Length = 281 Score = 25.8 bits (54), Expect = 6.0 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 220 KICIRCCYHQPNKRNVMSALHIVGDVIW 137 KI I C Y N + V +G+ +W Sbjct: 44 KILIECLYDTENHKRVRDTYKDIGEAVW 71 >SB_29746| Best HMM Match : Toxin_22 (HMM E-Value=3.8) Length = 259 Score = 25.8 bits (54), Expect = 6.0 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -2 Query: 98 DVHSLWY-LSCSPDHCLLYYTL 36 D +WY L CS D+ L++YTL Sbjct: 109 DYPLMWYTLDCSVDYPLMWYTL 130 >SB_41598| Best HMM Match : HLH (HMM E-Value=2.2) Length = 519 Score = 25.8 bits (54), Expect = 6.0 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -3 Query: 196 HQPNKRNVMSALHIVGDVIWMWNSFFYRSSNNGMCTVFGTFHAVRTIV 53 + + + A H V + + SSN+ T+ TFHAVR V Sbjct: 409 YNSRSQTIRHAFHAVRQYVMQFTQSDNTSSNSRSQTLRHTFHAVRQYV 456 >SB_35167| Best HMM Match : zf-HIT (HMM E-Value=0.046) Length = 632 Score = 25.8 bits (54), Expect = 6.0 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +1 Query: 106 YCSYRKNYSTSRLHPQRCARQT*HCAY*ADGNSTVYRFCTAHLFTVF-GLYATTP 267 YCS + R H RC +Q Y S++ H ++F G ++T P Sbjct: 39 YCSKEHKRADQRYHRHRCNKQPQEVPYTDSPESSMASLLGTHPGSIFQGDFSTIP 93 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 25.4 bits (53), Expect = 8.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 +IAL++L +TD + ICLP+ T+ Sbjct: 762 NIALVQLAHPLNFTDDIHAICLPTRKETE 790 >SB_5544| Best HMM Match : APG9 (HMM E-Value=7e-09) Length = 1288 Score = 25.4 bits (53), Expect = 8.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 83 WYLSCSPDHCL 51 WY + +PDHCL Sbjct: 305 WYFTSNPDHCL 315 >SB_3824| Best HMM Match : Trypsin (HMM E-Value=2.8026e-45) Length = 234 Score = 25.4 bits (53), Expect = 8.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLPS 244 R DIAL++L A D V CLPS Sbjct: 32 RDDIALLQLERPAQLNDRVNVACLPS 57 >SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) Length = 949 Score = 25.4 bits (53), Expect = 8.0 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +1 Query: 85 RLCTS--RCYCSYRKNYSTSRLHPQRCARQ 168 +LCT + Y Y++ ++ RLH RC R+ Sbjct: 774 KLCTKVLKGYPGYQRLQASRRLHSNRCRRE 803 >SB_7098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 25.4 bits (53), Expect = 8.0 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 62 PD-CMKGTKDCAHPVVTAPIEKTIPH 136 PD + G++DC VT+PI + PH Sbjct: 20 PDGILAGSQDCTPSTVTSPIVISTPH 45 >SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) Length = 1575 Score = 25.4 bits (53), Expect = 8.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 115 RSSNNGMCTVFGTFHAVRTIVC 50 RS N +C V +H+ +T+VC Sbjct: 51 RSLNANICAVDAAYHSRKTLVC 72 >SB_453| Best HMM Match : Neur_chan_LBD (HMM E-Value=2.1e-08) Length = 362 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 73 ERYQRLCTSRCYCSYRKNYSTSRLHP 150 E Y+ S C CS R + S+ +HP Sbjct: 197 EEYEDPSISGCLCSLRLDISSGEVHP 222 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,198,910 Number of Sequences: 59808 Number of extensions: 245868 Number of successful extensions: 707 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 326952314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -