BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G11 (294 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M13143-1|AAA60153.1| 638|Homo sapiens plasma prekallikrein prot... 44 9e-05 BC117351-1|AAI17352.1| 638|Homo sapiens kallikrein B, plasma (F... 44 9e-05 BC117349-1|AAI17350.1| 638|Homo sapiens kallikrein B, plasma (F... 44 9e-05 AY190920-1|AAN84794.1| 638|Homo sapiens kallikrein B, plasma (F... 44 9e-05 AF232742-1|AAF79940.1| 638|Homo sapiens plasma kallikrein precu... 44 9e-05 AC110771-1|AAY40900.1| 638|Homo sapiens unknown protein. 44 9e-05 BC051839-1|AAH51839.1| 492|Homo sapiens transmembrane protease,... 43 2e-04 AK222784-1|BAD96504.1| 492|Homo sapiens transmembrane protease,... 43 2e-04 AF329454-1|AAK53559.1| 492|Homo sapiens epitheliasin protein. 43 2e-04 AF270487-1|AAK29280.1| 492|Homo sapiens androgen-regulated seri... 43 2e-04 AF123453-1|AAD37117.1| 492|Homo sapiens transmembrane serine pr... 43 2e-04 U75329-1|AAC51784.1| 492|Homo sapiens serine protease protein. 42 4e-04 U33446-1|AAB19071.1| 343|Homo sapiens prostasin protein. 42 5e-04 L41351-1|AAC41759.1| 343|Homo sapiens prostasin protein. 42 5e-04 BC001462-1|AAH01462.1| 343|Homo sapiens protease, serine, 8 pro... 42 5e-04 M72150-1|AAA74885.1| 246|Homo sapiens cytotoxic serine proteina... 40 0.001 M57888-1|AAA03514.1| 246|Homo sapiens cytotoxic T-lymphocyte-as... 40 0.001 M36118-1|AAA03248.1| 246|Homo sapiens protein ( Human cytotoxin... 40 0.001 J02907-1|AAA76859.1| 246|Homo sapiens protein ( Human serine pr... 40 0.001 BC027974-1|AAH27974.1| 246|Homo sapiens granzyme H (cathepsin G... 40 0.001 BC030532-1|AAH30532.1| 855|Homo sapiens suppression of tumorige... 40 0.002 BC018146-1|AAH18146.1| 422|Homo sapiens ST14 protein protein. 40 0.002 BC005826-1|AAH05826.2| 526|Homo sapiens ST14 protein protein. 40 0.002 AF133086-1|AAF00109.1| 855|Homo sapiens membrane-type serine pr... 40 0.002 AF118224-1|AAD42765.2| 855|Homo sapiens matriptase protein. 40 0.002 AF057145-1|AAG15395.1| 855|Homo sapiens serine protease TADG15 ... 40 0.002 AB030036-1|BAB20376.1| 855|Homo sapiens prostamin protein. 40 0.002 M20218-1|AAA51985.1| 625|Homo sapiens coagulation factor XI pro... 39 0.003 M13142-1|AAA52487.1| 625|Homo sapiens F11 protein. 39 0.003 BC122863-1|AAI22864.1| 625|Homo sapiens coagulation factor XI (... 39 0.003 BC119014-1|AAI19015.1| 625|Homo sapiens coagulation factor XI (... 39 0.003 AY191837-1|AAN85554.1| 625|Homo sapiens coagulation factor XI (... 39 0.003 AF045649-1|AAC24506.1| 571|Homo sapiens platelet factor XI prot... 39 0.003 AC110771-2|AAY40901.1| 625|Homo sapiens unknown protein. 39 0.003 Y19124-1|CAB65555.1| 1019|Homo sapiens enteropeptidase protein. 38 0.004 X07732-1|CAA30558.1| 417|Homo sapiens hepsin protein. 38 0.004 X07002-1|CAA30058.1| 304|Homo sapiens hepsin protein. 38 0.004 U09860-1|AAC50138.1| 1019|Homo sapiens enterokinase protein. 38 0.004 M18930-1|AAA36013.1| 417|Homo sapiens protein ( Human hepsin mR... 38 0.004 BC121803-1|AAI21804.1| 425|Homo sapiens TMPRSS5 protein protein. 38 0.004 BC121802-1|AAI21803.1| 413|Homo sapiens TMPRSS5 protein protein. 38 0.004 BC111749-1|AAI11750.1| 1019|Homo sapiens protease, serine, 7 (en... 38 0.004 BC025716-1|AAH25716.1| 417|Homo sapiens hepsin (transmembrane p... 38 0.004 AL163217-2|CAB90389.1| 904|Homo sapiens human enterokinase; EC ... 38 0.004 AB028140-1|BAB20375.1| 457|Homo sapiens spinesin protein. 38 0.004 BX641029-1|CAE46018.1| 321|Homo sapiens hypothetical protein pr... 38 0.006 BC106946-1|AAI06947.1| 728|Homo sapiens mannan-binding lectin s... 38 0.006 BC106945-1|AAI06946.1| 728|Homo sapiens mannan-binding lectin s... 38 0.006 AF284421-1|AAK84071.1| 728|Homo sapiens complement factor MASP-... 38 0.006 D28593-1|BAA05928.1| 699|Homo sapiens MASP protein. 38 0.008 BC062334-1|AAH62334.1| 280|Homo sapiens protease, serine, 33 pr... 38 0.008 BC036846-1|AAH36846.2| 280|Homo sapiens PRSS33 protein protein. 38 0.008 AF536382-1|AAN04055.1| 284|Homo sapiens serine protease EOS pro... 38 0.008 AB007617-1|BAA89206.1| 699|Homo sapiens MASP/P100 protein. 38 0.008 X01793-1|CAA25926.1| 347|Homo sapiens haptoglobin protein. 37 0.010 X00637-1|CAA25267.1| 347|Homo sapiens haptoglobin alpha 1S prot... 37 0.010 X00606-1|CAA25248.1| 373|Homo sapiens hp2-alpha protein. 37 0.010 M69197-1|AAA88078.1| 406|Homo sapiens haptoglobin protein. 37 0.010 M28879-1|AAA75490.1| 247|Homo sapiens protein ( Human granzyme ... 37 0.010 M10935-1|AAA88080.1| 406|Homo sapiens haptoglobin protein. 37 0.010 L29394-1|AAA52685.1| 406|Homo sapiens haptoglobin alpha(2FS)-be... 37 0.010 K01763-1|AAA52684.1| 347|Homo sapiens HP protein. 37 0.010 K00422-1|AAA52687.1| 406|Homo sapiens HP protein. 37 0.010 J03189-1|AAA36603.1| 247|Homo sapiens protein ( Human proteolyt... 37 0.010 D17525-1|BAA04477.1| 699|Homo sapiens precursor of P100 serine ... 37 0.010 DQ314870-1|ABC40729.1| 406|Homo sapiens haptoglobin protein. 37 0.010 BC121125-1|AAI21126.1| 406|Homo sapiens haptoglobin protein. 37 0.010 BC121124-1|AAI21125.1| 347|Homo sapiens HP protein protein. 37 0.010 BC107587-1|AAI07588.1| 347|Homo sapiens HP protein protein. 37 0.010 BC070299-1|AAH70299.1| 281|Homo sapiens HP protein protein. 37 0.010 BC069331-1|AAH69331.1| 269|Homo sapiens elastase 2A protein. 37 0.010 BC058031-1|AAH58031.1| 228|Homo sapiens HP protein protein. 37 0.010 BC037775-1|AAH37775.1| 385|Homo sapiens testes-specific proteas... 37 0.010 BC033016-1|AAH33016.1| 385|Homo sapiens testes-specific proteas... 37 0.010 BC017862-1|AAH17862.1| 228|Homo sapiens HP protein protein. 37 0.010 AK222802-1|BAD96522.1| 487|Homo sapiens complement component 1,... 37 0.010 AK024084-1|BAB14819.1| 438|Homo sapiens protein ( Homo sapiens ... 37 0.010 AF178985-1|AAF44349.1| 487|Homo sapiens complement C1r-like pro... 37 0.010 AF100707-1|AAF22500.1| 385|Homo sapiens testes-specific protein... 37 0.010 AC004682-3|AAC27432.1| 345|Homo sapiens haptoglobin protein. 37 0.010 M38193-1|AAA67124.1| 247|Homo sapiens cytotoxic T-lymphocyte-as... 37 0.013 M17016-1|AAA36627.1| 247|Homo sapiens protein ( Human serine pr... 37 0.013 J04071-1|AAA52118.1| 247|Homo sapiens serine esterase protein. 37 0.013 J03072-1|AAB59528.1| 247|Homo sapiens CTLA1 protein. 37 0.013 BC030195-1|AAH30195.1| 247|Homo sapiens granzyme B (granzyme 2,... 37 0.013 AY372494-1|AAR23323.1| 281|Homo sapiens endogenous granzyme B p... 37 0.013 AY232654-1|AAP70244.1| 235|Homo sapiens granzyme B variant prot... 37 0.013 BC040887-1|AAH40887.1| 260|Homo sapiens kallikrein-related pept... 36 0.018 AY359036-1|AAQ89395.1| 260|Homo sapiens KLK8 protein. 36 0.018 AF243527-9|AAG33361.1| 260|Homo sapiens neuropsin protein. 36 0.018 AF095743-1|AAD29574.1| 260|Homo sapiens serine protease ovasin ... 36 0.018 AF095742-1|AAD25979.1| 260|Homo sapiens serine protease ovasin ... 36 0.018 AF055982-1|AAD56050.1| 260|Homo sapiens serine protease TADG14 ... 36 0.018 AC011473-1|AAG23254.1| 164|Homo sapiens kallikrein 8 (neuropsin... 36 0.018 AB012761-1|BAA28676.1| 164|Homo sapiens neuropsin protein. 36 0.018 AB009849-1|BAA28673.1| 260|Homo sapiens neuropsin protein. 36 0.018 AB008927-1|BAA82666.1| 305|Homo sapiens neuropsin type2 protein. 36 0.018 AB008390-1|BAA82665.1| 260|Homo sapiens neuropsin type1 protein. 36 0.018 BX537945-1|CAD97913.1| 416|Homo sapiens hypothetical protein pr... 35 0.041 BC126195-1|AAI26196.1| 416|Homo sapiens transmembrane protease,... 35 0.041 BC048112-1|AAH48112.1| 348|Homo sapiens transmembrane protease,... 35 0.041 BC035123-1|AAH35123.1| 320|Homo sapiens TMPRSS12 protein protein. 35 0.041 AL833167-1|CAD91168.1| 416|Homo sapiens hypothetical protein pr... 35 0.041 V00595-1|CAA23842.1| 615|Homo sapiens protein ( Homo sapiens mR... 35 0.054 M17262-1|AAC63054.1| 622|Homo sapiens prothrombin protein. 35 0.054 M13232-2|AAA88041.1| 444|Homo sapiens protein ( Human factor VI... 35 0.054 M13232-1|AAA88040.1| 466|Homo sapiens coagulation factor VII pr... 35 0.054 J02933-1|AAA51983.1| 466|Homo sapiens protein ( Human blood coa... 35 0.054 EF421855-1|ABN79862.1| 273|Homo sapiens coagulation factor VII ... 35 0.054 DQ142911-1|ABD17891.1| 466|Homo sapiens cogulation factor VII p... 35 0.054 BC130468-1|AAI30469.1| 444|Homo sapiens coagulation factor VII ... 35 0.054 BC051332-1|AAH51332.1| 622|Homo sapiens coagulation factor II (... 35 0.054 AY344794-1|AAR08143.1| 259|Homo sapiens prothrombin B-chain pro... 35 0.054 AY344793-1|AAR08142.1| 295|Homo sapiens prothrombin protein. 35 0.054 AY212252-1|AAP33841.1| 466|Homo sapiens FVII coagulation protei... 35 0.054 AL137002-10|CAI41381.1| 466|Homo sapiens coagulation factor VII... 35 0.054 AL137002-9|CAI41382.1| 444|Homo sapiens coagulation factor VII ... 35 0.054 AK222777-1|BAD96497.1| 622|Homo sapiens coagulation factor II p... 35 0.054 AK222775-1|BAD96495.1| 622|Homo sapiens coagulation factor II p... 35 0.054 AJ972449-1|CAJ01369.1| 622|Homo sapiens prothrombin protein. 35 0.054 AF478696-1|AAL77436.1| 622|Homo sapiens coagulation factor II (... 35 0.054 AF466933-1|AAL66184.1| 466|Homo sapiens coagulation factor VII ... 35 0.054 AF272774-1|AAK58686.2| 679|Homo sapiens factor VII active site ... 35 0.054 J00136-1|AAA98726.1| 462|Homo sapiens factor IX protein. 34 0.095 BC110451-1|AAI10452.1| 1042|Homo sapiens corin, serine peptidase... 34 0.095 BC074847-1|AAH74847.1| 454|Homo sapiens transmembrane protease,... 34 0.095 BC074846-1|AAH74846.1| 453|Homo sapiens transmembrane protease,... 34 0.095 BC011703-1|AAH11703.1| 437|Homo sapiens transmembrane protease,... 34 0.095 BC004855-1|AAH04855.1| 335|Homo sapiens transmembrane protease,... 34 0.095 AY633572-1|AAT66641.1| 538|Homo sapiens transmembrane protease ... 34 0.095 AY358530-1|AAQ88894.1| 432|Homo sapiens TMPRSS3 protein. 34 0.095 AY358458-1|AAQ88823.1| 453|Homo sapiens ECHOS1 protein. 34 0.095 AK172842-1|BAD18806.1| 453|Homo sapiens protein ( Homo sapiens ... 34 0.095 AK172766-1|BAD18749.1| 437|Homo sapiens protein ( Homo sapiens ... 34 0.095 AK131212-1|BAD18402.1| 211|Homo sapiens protein ( Homo sapiens ... 34 0.095 AJ544583-1|CAD67566.1| 293|Homo sapiens testis serine protease ... 34 0.095 AF216312-1|AAF31436.1| 423|Homo sapiens type II membrane serine... 34 0.095 AF201380-1|AAG37012.1| 455|Homo sapiens serine protease TADG12 ... 34 0.095 AF179224-1|AAF74526.1| 437|Homo sapiens transmembrane serine pr... 34 0.095 AF133845-1|AAD31850.1| 1042|Homo sapiens corin protein. 34 0.095 AB038159-1|BAB20079.1| 327|Homo sapiens serine protease protein. 34 0.095 AB038158-1|BAB20078.1| 327|Homo sapiens serine protease protein. 34 0.095 AB038157-1|BAB20077.1| 454|Homo sapiens serine protease protein. 34 0.095 X89214-1|CAA61501.1| 385|Homo sapiens haptoglobin-related prote... 33 0.13 X75363-1|CAA53145.1| 225|Homo sapiens serine protease homologue... 33 0.13 X06290-1|CAA29618.1| 4548|Homo sapiens protein ( Human mRNA for ... 33 0.13 M69197-2|AAA88079.1| 348|Homo sapiens haptoglobin-related prote... 33 0.13 M19063-1|AAA52456.1| 70|Homo sapiens F9 protein. 33 0.13 M16653-1|AAA52381.1| 269|Homo sapiens ELA1 protein. 33 0.13 M11309-1|AAA52023.1| 461|Homo sapiens F9 protein. 33 0.13 K03431-1|AAA88081.1| 348|Homo sapiens haptoglobin-related prote... 33 0.13 K02402-1|AAB59620.1| 461|Homo sapiens factor IX protein. 33 0.13 K02053-1|AAA56822.1| 461|Homo sapiens protein ( Human factor IX... 33 0.13 J00137-1|AAA52763.1| 461|Homo sapiens F9 protein. 33 0.13 DQ452068-1|ABF47086.1| 2040|Homo sapiens lipoprotein, Lp(a) prot... 33 0.13 DQ431840-1|ABF69029.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431839-1|ABF69028.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431838-1|ABF69027.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431837-1|ABF69026.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431836-1|ABF69025.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431835-1|ABF69024.1| 181|Homo sapiens coagulation factor IX p... 33 0.13 DQ431834-1|ABF69023.1| 181|Homo sapiens coagulation factor IX p... 33 0.13 DQ431833-1|ABF69022.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431832-1|ABF69021.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431831-1|ABF69020.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431830-1|ABF69019.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431829-1|ABF69018.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431828-1|ABF69017.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431827-1|ABF69016.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431826-1|ABF69015.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431825-1|ABF69014.1| 99|Homo sapiens truncated coagulation f... 33 0.13 DQ431824-1|ABF69013.1| 99|Homo sapiens truncated coagulation f... 33 0.13 DQ431823-1|ABF69012.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431822-1|ABF69011.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431821-1|ABF69010.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431816-1|ABF69005.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 DQ431811-1|ABF69000.1| 182|Homo sapiens coagulation factor IX p... 33 0.13 BC113542-1|AAI13543.1| 269|Homo sapiens elastase 2B protein. 33 0.13 BC113540-1|AAI13541.1| 269|Homo sapiens elastase 2B protein. 33 0.13 BC113414-1|AAI13415.1| 423|Homo sapiens transmembrane protease,... 33 0.13 BC113412-1|AAI13413.1| 423|Homo sapiens transmembrane protease,... 33 0.13 BC109215-1|AAI09216.1| 461|Homo sapiens F9 protein protein. 33 0.13 BC109214-1|AAI09215.1| 461|Homo sapiens F9 protein protein. 33 0.13 AY359017-1|AAQ89376.1| 423|Homo sapiens serine protease protein. 33 0.13 AL596089-1|CAH73590.1| 2040|Homo sapiens lipoprotein, Lp(a) prot... 33 0.13 AL109933-1|CAI22905.1| 2040|Homo sapiens lipoprotein, Lp(a) prot... 33 0.13 AL033403-1|CAI42103.1| 461|Homo sapiens coagulation factor IX (... 33 0.13 AF536327-1|AAM96188.1| 461|Homo sapiens coagulation factor IX (... 33 0.13 AF113248-1|AAF21966.1| 307|Homo sapiens heart specific serine p... 33 0.13 AF064819-1|AAF04328.1| 422|Homo sapiens serine protease DESC1 p... 33 0.13 AC079749-1|AAY40995.1| 419|Homo sapiens unknown protein. 33 0.13 AC004682-2|AAC27433.1| 346|Homo sapiens haptoglobin-related pro... 33 0.13 AB186358-1|BAD89383.1| 423|Homo sapiens coagulation factor IX p... 33 0.13 M16652-1|AAA52380.1| 269|Homo sapiens ELA1 protein. 33 0.17 M16631-1|AAA52374.1| 269|Homo sapiens ELA1 protein. 33 0.17 D00236-1|BAA00165.1| 269|Homo sapiens pancreatic elastase 2 pre... 33 0.17 CR450291-1|CAG29287.1| 269|Homo sapiens ELA2A protein. 33 0.17 BC069432-1|AAH69432.1| 269|Homo sapiens elastase 2A protein. 33 0.17 BC060513-1|AAH60513.1| 810|Homo sapiens plasminogen protein. 33 0.17 BC007031-1|AAH07031.1| 269|Homo sapiens elastase 2A protein. 33 0.17 AY358524-1|AAQ88888.1| 248|Homo sapiens KLK12 protein. 33 0.17 AL512883-1|CAC42421.1| 269|Homo sapiens elastase 2A (ELA2A) pro... 33 0.17 AF243527-13|AAG33365.1| 248|Homo sapiens kallikrein-like 5 prot... 33 0.17 AF135025-2|AAD26426.2| 248|Homo sapiens kallikrein-like protein... 33 0.17 AF135025-1|AAF06065.1| 254|Homo sapiens kallikrein-like protein... 33 0.17 AC011473-5|AAG23258.1| 254|Homo sapiens kallikrein 12 protein. 33 0.17 X05199-1|CAA28831.1| 810|Homo sapiens protein ( Human mRNA for ... 33 0.22 X01794-1|CAA25927.1| 348|Homo sapiens haptoglobin protein. 33 0.22 M74220-1|AAA36451.1| 810|Homo sapiens plasminogen protein. 33 0.22 M34276-1|AAA60113.1| 810|Homo sapiens plasminogen protein. 33 0.22 K02922-1|AAA60124.1| 519|Homo sapiens PLG protein. 33 0.22 BC126137-1|AAI26138.1| 256|Homo sapiens kallikrein-related pept... 33 0.22 BC121109-1|AAI21110.1| 328|Homo sapiens ESSPL protein protein. 33 0.22 BC069518-1|AAH69518.1| 255|Homo sapiens kallikrein-related pept... 33 0.22 BC069507-1|AAH69507.1| 256|Homo sapiens kallikrein-related pept... 33 0.22 BC069480-1|AAH69480.1| 255|Homo sapiens kallikrein-related pept... 33 0.22 BC034294-1|AAH34294.1| 290|Homo sapiens protease, serine 27 pro... 33 0.22 AY373374-1|AAQ82621.1| 162|Homo sapiens kallikrein 15 isoform 6... 33 0.22 AY373373-1|AAQ82620.1| 162|Homo sapiens kallikrein 15 isoform 5... 33 0.22 AY359106-1|AAQ89464.1| 290|Homo sapiens MPN protein. 33 0.22 AY192161-1|AAN85555.1| 810|Homo sapiens plasminogen protein. 33 0.22 AY030095-1|AAK38168.1| 290|Homo sapiens pancreasin protein. 33 0.22 AL109933-5|CAI22908.1| 810|Homo sapiens plasminogen protein. 33 0.22 AJ306593-1|CAC35467.1| 290|Homo sapiens marapsin protein. 33 0.22 AF303046-1|AAK62813.1| 255|Homo sapiens prostinogen protein. 33 0.22 AF243527-2|AAG33354.1| 247|Homo sapiens ACO protease protein. 33 0.22 AF242195-3|AAG09471.1| 161|Homo sapiens KLK15 splice variant 2 ... 33 0.22 AF242195-1|AAG09469.1| 256|Homo sapiens KLK15 protein. 33 0.22 AB056161-1|BAB85497.1| 290|Homo sapiens serine protease 27 prot... 33 0.22 BC009726-1|AAH09726.1| 317|Homo sapiens protease, serine, 22 pr... 32 0.38 AY358396-1|AAQ88762.1| 334|Homo sapiens PRSS22 protein. 32 0.38 AF321182-1|AAG35070.1| 317|Homo sapiens serine protease PRSS22 ... 32 0.38 AC003965-1|AAB93671.1| 271|Homo sapiens SP001LA protein. 32 0.38 AB010779-1|BAB20263.1| 317|Homo sapiens brain-specific serine p... 32 0.38 DQ431820-1|ABF69009.1| 182|Homo sapiens coagulation factor IX p... 31 0.51 DQ431818-1|ABF69007.1| 182|Homo sapiens coagulation factor IX p... 31 0.51 BC069455-1|AAH69455.1| 269|Homo sapiens elastase 2B protein. 31 0.51 BC069412-1|AAH69412.1| 269|Homo sapiens elastase 2B protein. 31 0.51 AY498712-1|AAS78642.1| 417|Homo sapiens epidermal type II trans... 31 0.51 AL512883-2|CAC42422.1| 269|Homo sapiens pancreatic elastase IIB... 31 0.51 AJ488947-1|CAD35759.1| 855|Homo sapiens polyserase-IB protein p... 31 0.51 AJ488946-1|CAD35758.1| 1059|Homo sapiens polyserase-IA protein p... 31 0.51 AB109390-1|BAF02295.1| 531|Homo sapiens Serase-1B protein. 31 0.51 BC111796-1|AAI11797.1| 418|Homo sapiens TMPRSS11A protein protein. 31 0.67 AL844853-12|CAI41860.1| 764|Homo sapiens B-factor, properdin pr... 31 0.67 AK131518-1|BAD18660.1| 421|Homo sapiens protein ( Homo sapiens ... 31 0.67 AK122625-1|BAC85495.1| 438|Homo sapiens protein ( Homo sapiens ... 31 0.67 X87904-1|CAB57277.1| 2135|Homo sapiens semaphorin receptor protein. 31 0.89 X72875-1|CAA51389.1| 764|Homo sapiens complement factor B protein. 31 0.89 S67310-1|AAD13989.1| 764|Homo sapiens complement factor B protein. 31 0.89 L15702-1|AAA16820.1| 764|Homo sapiens complement factor B protein. 31 0.89 K01566-1|AAA36225.2| 677|Homo sapiens MHC serum complement fact... 31 0.89 BX005143-8|CAM25864.1| 764|Homo sapiens complement factor B pro... 31 0.89 BC146793-1|AAI46794.1| 2135|Homo sapiens plexin B1 protein. 31 0.89 BC007990-1|AAH07990.1| 764|Homo sapiens complement factor B pro... 31 0.89 BC004143-1|AAH04143.1| 764|Homo sapiens complement factor B pro... 31 0.89 AL662849-6|CAI17456.1| 764|Homo sapiens complement factor B pro... 31 0.89 AL645922-7|CAI41725.2| 764|Homo sapiens complement factor B pro... 31 0.89 AK223400-1|BAD97120.1| 764|Homo sapiens complement factor B pre... 31 0.89 AJ011415-1|CAB56222.1| 1952|Homo sapiens plexin-B1/SEP receptor ... 31 0.89 AJ011414-1|CAB56221.1| 729|Homo sapiens plexin-B1/SEP receptor ... 31 0.89 AF551848-1|AAN71991.1| 764|Homo sapiens B-factor, properdin pro... 31 0.89 AF019413-8|AAB67977.1| 764|Homo sapiens complement factor B pro... 31 0.89 AB007867-1|BAA23703.2| 2143|Homo sapiens KIAA0407 protein. 31 0.89 X04701-1|CAA28407.1| 705|Homo sapiens protein ( Human mRNA for ... 30 1.2 M14058-1|AAA51851.1| 705|Homo sapiens C1R protein. 30 1.2 BC075000-1|AAH75000.1| 314|Homo sapiens testisin, isoform 1 pro... 30 1.2 BC074999-1|AAH74999.1| 314|Homo sapiens protease, serine, 21 (t... 30 1.2 BC035220-1|AAH35220.1| 705|Homo sapiens complement component 1,... 30 1.2 AY359034-1|AAQ89393.1| 314|Homo sapiens PRSS21 protein. 30 1.2 AK222491-1|BAD96211.1| 705|Homo sapiens complement component 1,... 30 1.2 AK222481-1|BAD96201.1| 705|Homo sapiens complement component 1,... 30 1.2 AK131261-1|BAD18439.1| 307|Homo sapiens protein ( Homo sapiens ... 30 1.2 AF058301-2|AAF79020.1| 312|Homo sapiens testisin protein. 30 1.2 AF058301-1|AAF79019.1| 314|Homo sapiens testisin protein. 30 1.2 AF058300-1|AAD41588.1| 314|Homo sapiens testisin protein. 30 1.2 AB083037-1|BAC19850.2| 705|Homo sapiens r subcomponent of compl... 30 1.2 AB031331-1|BAA89532.1| 300|Homo sapiens eosinophil serine prote... 30 1.2 AB031330-1|BAA83521.1| 314|Homo sapiens eosinophil serine prote... 30 1.2 AB031329-1|BAA83520.1| 314|Homo sapiens eosinophil serine prote... 30 1.2 X02750-1|CAA26528.1| 461|Homo sapiens protein ( Human liver mRN... 30 1.5 M12712-1|AAA60165.1| 462|Homo sapiens PROC protein. 30 1.5 M11228-1|AAA60166.1| 461|Homo sapiens protein ( Human protein C... 30 1.5 K02059-1|AAA60164.1| 356|Homo sapiens protein C protein. 30 1.5 D50030-1|BAA74450.1| 655|Homo sapiens hepatocyte growth factor ... 30 1.5 D14012-1|BAA03113.1| 655|Homo sapiens HGF activator precursor p... 30 1.5 DQ431817-1|ABF69006.1| 182|Homo sapiens coagulation factor IX p... 30 1.5 DQ384431-1|ABD48880.1| 241|Homo sapiens trypsin X3 protein. 30 1.5 DQ384429-1|ABD48879.1| 241|Homo sapiens trypsin X3 protein. 30 1.5 DQ384428-1|ABD48878.1| 241|Homo sapiens trypsin X3 protein. 30 1.5 DQ384427-1|ABD48877.1| 241|Homo sapiens trypsin X3 protein. 30 1.5 DQ384426-1|ABD48876.1| 241|Homo sapiens trypsin X3 protein. 30 1.5 BC112192-1|AAI12193.1| 655|Homo sapiens HGF activator, prepropr... 30 1.5 BC112190-1|AAI12191.1| 655|Homo sapiens HGF activator, prepropr... 30 1.5 BC035384-1|AAH35384.1| 241|Homo sapiens trypsin X3 protein. 30 1.5 BC034377-1|AAH34377.1| 461|Homo sapiens protein C (inactivator ... 30 1.5 AY454079-1|AAR23427.1| 195|Homo sapiens protein C protein. 30 1.5 AY358487-1|AAQ88851.1| 241|Homo sapiens KFIL2540 protein. 30 1.5 AY348554-1|AAQ24850.1| 144|Homo sapiens protein C protein. 30 1.5 AY348553-1|AAQ24849.1| 144|Homo sapiens protein C protein. 30 1.5 AL590235-6|CAM21456.1| 655|Homo sapiens HGF activator protein. 30 1.5 AF378903-1|AAK56377.1| 461|Homo sapiens protein C protein. 30 1.5 AC068282-2|AAY15044.1| 461|Homo sapiens unknown protein. 30 1.5 AB086852-1|BAC54280.1| 195|Homo sapiens Protein C protein. 30 1.5 AB083696-1|BAC21168.1| 195|Homo sapiens Protein C protein. 30 1.5 AB083695-1|BAC21167.1| 195|Homo sapiens Protein C protein. 30 1.5 AB083693-1|BAC21166.1| 195|Homo sapiens Protein C protein. 30 1.5 AB083690-1|BAC21165.1| 211|Homo sapiens Protein C protein. 30 1.5 Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for ... 29 2.0 S39329-2|AAD13817.1| 223|Homo sapiens glandular kallikrein-1 pr... 29 2.0 S39329-1|AAD13816.1| 261|Homo sapiens glandular kallikrein-1 pr... 29 2.0 M18157-1|AAA74454.1| 261|Homo sapiens protein ( Human glandular... 29 2.0 CR456446-1|CAG30332.1| 824|Homo sapiens dJ1170K4.2 protein. 29 2.0 BT006650-1|AAP35296.1| 261|Homo sapiens kallikrein 2, prostatic... 29 2.0 BC005196-1|AAH05196.1| 261|Homo sapiens kallikrein-related pept... 29 2.0 BC000051-1|AAH00051.1| 316|Homo sapiens Fas apoptotic inhibitor... 29 2.0 AY429509-1|AAR10468.1| 180|Homo sapiens kallikrein 2 isoform 5 ... 29 2.0 AY358398-1|AAQ88764.1| 802|Homo sapiens PVAE354 protein. 29 2.0 AY055384-1|AAL16414.1| 811|Homo sapiens type II transmembrane s... 29 2.0 AY055383-1|AAL16413.1| 811|Homo sapiens type II transmembrane s... 29 2.0 AL022314-2|CAI19335.1| 788|Homo sapiens protein ( (beta-1,4-)-g... 29 2.0 AJ319876-1|CAC85953.1| 802|Homo sapiens matriptase-2 protein. 29 2.0 AF243527-4|AAG33356.1| 261|Homo sapiens glandular kallikrein pr... 29 2.0 AF188747-1|AAF08277.1| 223|Homo sapiens prostrate kallikrein 2 ... 29 2.0 AF188746-1|AAF08276.1| 261|Homo sapiens prostrate kallikrein 2 ... 29 2.0 AF188745-1|AAF08275.1| 164|Homo sapiens prostrate kallikrein 2 ... 29 2.0 AB023167-1|BAA76794.1| 343|Homo sapiens KIAA0950 protein protein. 29 2.0 L36936-1|AAA57257.1| 230|Homo sapiens metase protein. 29 2.7 L23134-1|AAA59582.1| 257|Homo sapiens metase protein. 29 2.7 BC125196-1|AAI25197.1| 418|Homo sapiens transmembrane protease,... 29 2.7 BC125195-1|AAI25196.1| 418|Homo sapiens transmembrane protease,... 29 2.7 BC025701-1|AAH25701.1| 257|Homo sapiens granzyme M (lymphocyte ... 29 2.7 AB002134-1|BAA28691.1| 418|Homo sapiens airway trypsin-like pro... 29 2.7 U14391-1|AAA62667.1| 1109|Homo sapiens myosin-IC protein. 29 3.6 M31315-1|AAA70225.1| 612|Homo sapiens F12 protein. 29 3.6 M17466-1|AAB59490.1| 615|Homo sapiens coagulation factor XII pr... 29 3.6 M13147-1|AAA70224.1| 470|Homo sapiens F12 protein. 29 3.6 M11723-1|AAA51986.1| 602|Homo sapiens F12 protein. 29 3.6 L43615-1|AAB59491.1| 237|Homo sapiens coagulation factor XII pr... 29 3.6 BT007350-1|AAP36014.1| 300|Homo sapiens coagulation factor XII ... 29 3.6 BC098392-1|AAH98392.1| 1108|Homo sapiens myosin IE protein. 29 3.6 BC075091-1|AAH75091.2| 258|Homo sapiens elastase 1, pancreatic ... 29 3.6 BC069454-1|AAH69454.1| 258|Homo sapiens elastase 1, pancreatic ... 29 3.6 BC012390-1|AAH12390.1| 300|Homo sapiens F12 protein protein. 29 3.6 AY740424-1|AAV88109.1| 204|Homo sapiens elastase 1, pancreatic,... 29 3.6 AF538691-1|AAM97932.1| 615|Homo sapiens coagulation factor XII ... 29 3.6 AF120493-1|AAD28441.1| 258|Homo sapiens elastase 1 precursor pr... 29 3.6 AF071882-1|AAD41463.1| 391|Homo sapiens esophageal cancer susce... 29 3.6 AB095845-1|BAC23095.1| 615|Homo sapiens coagulation factor XII-... 29 3.6 U10554-1|AAB92675.1| 532|Homo sapiens vesicular acetylcholine t... 28 4.7 U09210-1|AAA20497.1| 532|Homo sapiens vesicular acetylcholine t... 28 4.7 BC089434-1|AAH89434.1| 737|Homo sapiens regeneration associated... 28 4.7 BC007765-1|AAH07765.1| 532|Homo sapiens solute carrier family 1... 28 4.7 AY358346-1|AAQ88712.1| 720|Homo sapiens ELGC699 protein. 28 4.7 AL050214-1|CAB43317.1| 181|Homo sapiens hypothetical protein pr... 28 4.7 AK027841-1|BAB55404.1| 737|Homo sapiens protein ( Homo sapiens ... 28 4.7 BC069543-1|AAH69543.1| 277|Homo sapiens kallikrein-related pept... 28 6.2 BC069334-1|AAH69334.1| 277|Homo sapiens kallikrein-related pept... 28 6.2 AF135024-1|AAD26425.2| 277|Homo sapiens kallikrein-like protein... 28 6.2 AC011473-6|AAG23259.1| 277|Homo sapiens kallikrein 13 protein. 28 6.2 AF175759-1|AAF03697.1| 321|Homo sapiens transmembrane tryptase ... 27 8.2 AF175522-1|AAF03695.1| 321|Homo sapiens transmembrane tryptase ... 27 8.2 AE006466-4|AAK61269.1| 321|Homo sapiens HS transmembrane trypta... 27 8.2 >M13143-1|AAA60153.1| 638|Homo sapiens plasma prekallikrein protein. Length = 638 Score = 44.0 bits (99), Expect = 9e-05 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 I++ I H +Y ++ G HDIALI+L YT+F +PICLPS Sbjct: 466 IKEIIIHQNYKVSE--GNHDIALIKLQAPLNYTEFQKPICLPS 506 >BC117351-1|AAI17352.1| 638|Homo sapiens kallikrein B, plasma (Fletcher factor) 1 protein. Length = 638 Score = 44.0 bits (99), Expect = 9e-05 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 I++ I H +Y ++ G HDIALI+L YT+F +PICLPS Sbjct: 466 IKEIIIHQNYKVSE--GNHDIALIKLQAPLNYTEFQKPICLPS 506 >BC117349-1|AAI17350.1| 638|Homo sapiens kallikrein B, plasma (Fletcher factor) 1 protein. Length = 638 Score = 44.0 bits (99), Expect = 9e-05 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 I++ I H +Y ++ G HDIALI+L YT+F +PICLPS Sbjct: 466 IKEIIIHQNYKVSE--GNHDIALIKLQAPLNYTEFQKPICLPS 506 >AY190920-1|AAN84794.1| 638|Homo sapiens kallikrein B, plasma (Fletcher factor) 1 protein. Length = 638 Score = 44.0 bits (99), Expect = 9e-05 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 I++ I H +Y ++ G HDIALI+L YT+F +PICLPS Sbjct: 466 IKEIIIHQNYKVSE--GNHDIALIKLQAPLNYTEFQKPICLPS 506 >AF232742-1|AAF79940.1| 638|Homo sapiens plasma kallikrein precursor protein. Length = 638 Score = 44.0 bits (99), Expect = 9e-05 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 I++ I H +Y ++ G HDIALI+L YT+F +PICLPS Sbjct: 466 IKEIIIHQNYKVSE--GNHDIALIKLQAPLNYTEFQKPICLPS 506 >AC110771-1|AAY40900.1| 638|Homo sapiens unknown protein. Length = 638 Score = 44.0 bits (99), Expect = 9e-05 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 I++ I H +Y ++ G HDIALI+L YT+F +PICLPS Sbjct: 466 IKEIIIHQNYKVSE--GNHDIALIKLQAPLNYTEFQKPICLPS 506 >BC051839-1|AAH51839.1| 492|Homo sapiens transmembrane protease, serine 2 protein. Length = 492 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +EK I HP+Y + +DIAL++L + D V+P+CLP+ QP W Sbjct: 328 VEKVISHPNY--DSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCW 380 >AK222784-1|BAD96504.1| 492|Homo sapiens transmembrane protease, serine 2 variant protein. Length = 492 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +EK I HP+Y + +DIAL++L + D V+P+CLP+ QP W Sbjct: 328 VEKVISHPNY--DSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCW 380 >AF329454-1|AAK53559.1| 492|Homo sapiens epitheliasin protein. Length = 492 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +EK I HP+Y + +DIAL++L + D V+P+CLP+ QP W Sbjct: 328 VEKVISHPNY--DSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCW 380 >AF270487-1|AAK29280.1| 492|Homo sapiens androgen-regulated serine protease TMPRSS2 precursor protein. Length = 492 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +EK I HP+Y + +DIAL++L + D V+P+CLP+ QP W Sbjct: 328 VEKVISHPNY--DSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCW 380 >AF123453-1|AAD37117.1| 492|Homo sapiens transmembrane serine protease 2 protein. Length = 492 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +EK I HP+Y + +DIAL++L + D V+P+CLP+ QP W Sbjct: 328 VEKVISHPNY--DSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCW 380 >U75329-1|AAC51784.1| 492|Homo sapiens serine protease protein. Length = 492 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 ++K I HP+Y + +DIAL++L + D V+P+CLP+ QP W Sbjct: 328 VQKVISHPNY--DSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCW 380 >U33446-1|AAB19071.1| 343|Homo sapiens prostasin protein. Length = 343 Score = 41.5 bits (93), Expect = 5e-04 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ IPHP Y+ QG DIAL++L ++ ++RPICLP+ Sbjct: 117 LKDIIPHPSYLQEGSQG--DIALLQLSRPITFSRYIRPICLPA 157 >L41351-1|AAC41759.1| 343|Homo sapiens prostasin protein. Length = 343 Score = 41.5 bits (93), Expect = 5e-04 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ IPHP Y+ QG DIAL++L ++ ++RPICLP+ Sbjct: 117 LKDIIPHPSYLQEGSQG--DIALLQLSRPITFSRYIRPICLPA 157 >BC001462-1|AAH01462.1| 343|Homo sapiens protease, serine, 8 protein. Length = 343 Score = 41.5 bits (93), Expect = 5e-04 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ IPHP Y+ QG DIAL++L ++ ++RPICLP+ Sbjct: 117 LKDIIPHPSYLQEGSQG--DIALLQLSRPITFSRYIRPICLPA 157 >M72150-1|AAA74885.1| 246|Homo sapiens cytotoxic serine proteinase protein. Length = 246 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A +T VRP+ LPS Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKWTTAVRPLRLPS-SKAQVKPGQ 140 >M57888-1|AAA03514.1| 246|Homo sapiens cytotoxic T-lymphocyte-associated serine esterase 1 protein. Length = 246 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A +T VRP+ LPS Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKWTTAVRPLRLPS-SKAQVKPGQ 140 >M36118-1|AAA03248.1| 246|Homo sapiens protein ( Human cytotoxin serine protease-C mRNA, complete cds. ). Length = 246 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A +T VRP+ LPS Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKWTTAVRPLRLPS-SKAQVKPGQ 140 >J02907-1|AAA76859.1| 246|Homo sapiens protein ( Human serine protease gene, complete cds. ). Length = 246 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A +T VRP+ LPS Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKWTTAVRPLRLPS-SKAQVKPGQ 140 >BC027974-1|AAH27974.1| 246|Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) protein. Length = 246 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A +T VRP+ LPS Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKWTTAVRPLRLPS-SKAQVKPGQ 140 >BC030532-1|AAH30532.1| 855|Homo sapiens suppression of tumorigenicity 14 (colon carcinoma) protein. Length = 855 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +++ I HP + ND +DIAL+ L A Y+ VRPICLP + W Sbjct: 694 LKRIISHPFF--NDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIW 746 >BC018146-1|AAH18146.1| 422|Homo sapiens ST14 protein protein. Length = 422 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +++ I HP + ND +DIAL+ L A Y+ VRPICLP + W Sbjct: 261 LKRIISHPFF--NDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIW 313 >BC005826-1|AAH05826.2| 526|Homo sapiens ST14 protein protein. Length = 526 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +++ I HP + ND +DIAL+ L A Y+ VRPICLP + W Sbjct: 365 LKRIISHPFF--NDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIW 417 >AF133086-1|AAF00109.1| 855|Homo sapiens membrane-type serine protease 1 protein. Length = 855 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +++ I HP + ND +DIAL+ L A Y+ VRPICLP + W Sbjct: 694 LKRIISHPFF--NDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIW 746 >AF118224-1|AAD42765.2| 855|Homo sapiens matriptase protein. Length = 855 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +++ I HP + ND +DIAL+ L A Y+ VRPICLP + W Sbjct: 694 LKRIISHPFF--NDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIW 746 >AF057145-1|AAG15395.1| 855|Homo sapiens serine protease TADG15 protein. Length = 855 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +++ I HP + ND +DIAL+ L A Y+ VRPICLP + W Sbjct: 694 LKRIISHPFF--NDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIW 746 >AB030036-1|BAB20376.1| 855|Homo sapiens prostamin protein. Length = 855 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +++ I HP + ND +DIAL+ L A Y+ VRPICLP + W Sbjct: 694 LKRIISHPFF--NDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIW 746 >M20218-1|AAA51985.1| 625|Homo sapiens coagulation factor XI protein. Length = 625 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +++ I H Y + +DIAL++L T YTD RPICLPS Sbjct: 463 VQEIIIHDQY--KMAESGYDIALLKLETTVNYTDSQRPICLPS 503 >M13142-1|AAA52487.1| 625|Homo sapiens F11 protein. Length = 625 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +++ I H Y + +DIAL++L T YTD RPICLPS Sbjct: 463 VQEIIIHDQY--KMAESGYDIALLKLETTVNYTDSQRPICLPS 503 >BC122863-1|AAI22864.1| 625|Homo sapiens coagulation factor XI (plasma thromboplastin antecedent) protein. Length = 625 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +++ I H Y + +DIAL++L T YTD RPICLPS Sbjct: 463 VQEIIIHDQY--KMAESGYDIALLKLETTVNYTDSQRPICLPS 503 >BC119014-1|AAI19015.1| 625|Homo sapiens coagulation factor XI (plasma thromboplastin antecedent) protein. Length = 625 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +++ I H Y + +DIAL++L T YTD RPICLPS Sbjct: 463 VQEIIIHDQY--KMAESGYDIALLKLETTVNYTDSQRPICLPS 503 >AY191837-1|AAN85554.1| 625|Homo sapiens coagulation factor XI (plasma thromboplastin antecedent) protein. Length = 625 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +++ I H Y + +DIAL++L T YTD RPICLPS Sbjct: 463 VQEIIIHDQY--KMAESGYDIALLKLETTVNYTDSQRPICLPS 503 >AF045649-1|AAC24506.1| 571|Homo sapiens platelet factor XI protein. Length = 571 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +++ I H Y + +DIAL++L T YTD RPICLPS Sbjct: 409 VQEIIIHDQY--KMAESGYDIALLKLETTVNYTDSQRPICLPS 449 >AC110771-2|AAY40901.1| 625|Homo sapiens unknown protein. Length = 625 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +++ I H Y + +DIAL++L T YTD RPICLPS Sbjct: 463 VQEIIIHDQY--KMAESGYDIALLKLETTVNYTDSQRPICLPS 503 >Y19124-1|CAB65555.1| 1019|Homo sapiens enteropeptidase protein. Length = 1019 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/53 (37%), Positives = 32/53 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 I++ + +P Y N + +DIA++ L YTD+++PICLP + PPGR Sbjct: 859 IDEIVINPHY--NRRRKDNDIAMMHLEFKVNYTDYIQPICLPE-ENQVFPPGR 908 >X07732-1|CAA30558.1| 417|Homo sapiens hepsin protein. Length = 417 Score = 38.3 bits (85), Expect = 0.004 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Frame = +2 Query: 116 IEKTIPHPDYIP----NDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ + H Y+P N + +DIAL+ L P T++++P+CLP+ Sbjct: 234 VQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPA 280 >X07002-1|CAA30058.1| 304|Homo sapiens hepsin protein. Length = 304 Score = 38.3 bits (85), Expect = 0.004 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Frame = +2 Query: 116 IEKTIPHPDYIP----NDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ + H Y+P N + +DIAL+ L P T++++P+CLP+ Sbjct: 121 VQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPA 167 >U09860-1|AAC50138.1| 1019|Homo sapiens enterokinase protein. Length = 1019 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/53 (37%), Positives = 32/53 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 I++ + +P Y N + +DIA++ L YTD+++PICLP + PPGR Sbjct: 859 IDEIVINPHY--NRRRKDNDIAMMHLEFKVNYTDYIQPICLPE-ENQVFPPGR 908 >M18930-1|AAA36013.1| 417|Homo sapiens protein ( Human hepsin mRNA, complete cds. ). Length = 417 Score = 38.3 bits (85), Expect = 0.004 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Frame = +2 Query: 116 IEKTIPHPDYIP----NDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ + H Y+P N + +DIAL+ L P T++++P+CLP+ Sbjct: 234 VQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPA 280 >BC121803-1|AAI21804.1| 425|Homo sapiens TMPRSS5 protein protein. Length = 425 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +2 Query: 110 APIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 A +E+ IPHP Y + +D+AL+RL ++D V +CLP+ + R W Sbjct: 257 ALVERIIPHPLYSAQNHD--YDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCW 311 >BC121802-1|AAI21803.1| 413|Homo sapiens TMPRSS5 protein protein. Length = 413 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +2 Query: 110 APIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 A +E+ IPHP Y + +D+AL+RL ++D V +CLP+ + R W Sbjct: 245 ALVERIIPHPLYSAQNHD--YDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCW 299 >BC111749-1|AAI11750.1| 1019|Homo sapiens protease, serine, 7 (enterokinase) protein. Length = 1019 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/53 (37%), Positives = 32/53 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 I++ + +P Y N + +DIA++ L YTD+++PICLP + PPGR Sbjct: 859 IDEIVINPHY--NRRRKDNDIAMMHLEFKVNYTDYIQPICLPE-ENQVFPPGR 908 >BC025716-1|AAH25716.1| 417|Homo sapiens hepsin (transmembrane protease, serine 1) protein. Length = 417 Score = 38.3 bits (85), Expect = 0.004 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Frame = +2 Query: 116 IEKTIPHPDYIP----NDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ + H Y+P N + +DIAL+ L P T++++P+CLP+ Sbjct: 234 VQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPA 280 >AL163217-2|CAB90389.1| 904|Homo sapiens human enterokinase; EC 3.4.21.9. protein. Length = 904 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/53 (37%), Positives = 32/53 (60%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 I++ + +P Y N + +DIA++ L YTD+++PICLP + PPGR Sbjct: 744 IDEIVINPHY--NRRRKDNDIAMMHLEFKVNYTDYIQPICLPE-ENQVFPPGR 793 >AB028140-1|BAB20375.1| 457|Homo sapiens spinesin protein. Length = 457 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +2 Query: 110 APIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 A +E+ IPHP Y + +D+AL+RL ++D V +CLP+ + R W Sbjct: 289 ALVERIIPHPLYSAQNHD--YDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCW 343 >BX641029-1|CAE46018.1| 321|Homo sapiens hypothetical protein protein. Length = 321 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLD 250 V + + + HPD+ N HDIAL++L P V P+CLP L+ Sbjct: 125 VNSSAARVVLHPDF--NIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLE 171 >BC106946-1|AAI06947.1| 728|Homo sapiens mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reac protein. Length = 728 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLD 250 V + + + HPD+ N HDIAL++L P V P+CLP L+ Sbjct: 532 VNSSAARVVLHPDF--NIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLE 578 >BC106945-1|AAI06946.1| 728|Homo sapiens mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reac protein. Length = 728 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLD 250 V + + + HPD+ N HDIAL++L P V P+CLP L+ Sbjct: 532 VNSSAARVVLHPDF--NIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLE 578 >AF284421-1|AAK84071.1| 728|Homo sapiens complement factor MASP-3 protein. Length = 728 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLD 250 V + + + HPD+ N HDIAL++L P V P+CLP L+ Sbjct: 532 VNSSAARVVLHPDF--NIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLE 578 >D28593-1|BAA05928.1| 699|Homo sapiens MASP protein. Length = 699 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 ++ T HP Y PN + +D+AL+ L+ + FV PICLP Sbjct: 535 VKHTTLHPQYDPNTFE--NDVALVELLESPVLNAFVMPICLP 574 >BC062334-1|AAH62334.1| 280|Homo sapiens protease, serine, 33 protein. Length = 280 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/56 (32%), Positives = 33/56 (58%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPG 271 ++ P+ + + PDY + +G D+AL++L P + V+P+CLP + + PPG Sbjct: 105 LSVPVRRVLLPPDYSEDGARG--DLALLQLRRPVPLSARVQPVCLP-VPGARPPPG 157 >BC036846-1|AAH36846.2| 280|Homo sapiens PRSS33 protein protein. Length = 280 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/56 (32%), Positives = 33/56 (58%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPG 271 ++ P+ + + PDY + +G D+AL++L P + V+P+CLP + + PPG Sbjct: 105 LSVPVRRVLLPPDYSEDGARG--DLALLQLRRPVPLSARVQPVCLP-VPGARPPPG 157 >AF536382-1|AAN04055.1| 284|Homo sapiens serine protease EOS protein. Length = 284 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/56 (32%), Positives = 33/56 (58%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPG 271 ++ P+ + + PDY + +G D+AL++L P + V+P+CLP + + PPG Sbjct: 105 LSVPVRRVLLPPDYSEDGARG--DLALLQLRRPVPLSARVQPVCLP-VPGARPPPG 157 >AB007617-1|BAA89206.1| 699|Homo sapiens MASP/P100 protein. Length = 699 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 ++ T HP Y PN + +D+AL+ L+ + FV PICLP Sbjct: 535 VKHTTLHPQYDPNTFE--NDVALVELLESPVLNAFVMPICLP 574 >X01793-1|CAA25926.1| 347|Homo sapiens haptoglobin protein. Length = 347 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 174 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 215 >X00637-1|CAA25267.1| 347|Homo sapiens haptoglobin alpha 1S protein. Length = 347 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 174 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 215 >X00606-1|CAA25248.1| 373|Homo sapiens hp2-alpha protein. Length = 373 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 231 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 272 >M69197-1|AAA88078.1| 406|Homo sapiens haptoglobin protein. Length = 406 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 233 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 274 >M28879-1|AAA75490.1| 247|Homo sapiens protein ( Human granzyme B (CTLA-1) gene, complete cds. ). Length = 247 Score = 37.1 bits (82), Expect = 0.010 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A T V+P+ LPS + Q PG+ Sbjct: 90 PVKRAIPHPAYNPKNFS--NDIMLLQLERKAKRTRAVQPLRLPS-NKAQVKPGQ 140 >M10935-1|AAA88080.1| 406|Homo sapiens haptoglobin protein. Length = 406 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 233 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 274 >L29394-1|AAA52685.1| 406|Homo sapiens haptoglobin alpha(2FS)-beta precursor protein. Length = 406 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 233 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 274 >K01763-1|AAA52684.1| 347|Homo sapiens HP protein. Length = 347 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 174 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 215 >K00422-1|AAA52687.1| 406|Homo sapiens HP protein. Length = 406 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 233 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 274 >J03189-1|AAA36603.1| 247|Homo sapiens protein ( Human proteolytic serine esterase-like protein (SECT) gene, complete cds. ). Length = 247 Score = 37.1 bits (82), Expect = 0.010 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A T V+P+ LPS + Q PG+ Sbjct: 90 PVKRAIPHPAYNPKNFS--NDIMLLQLERKAKRTRAVQPLRLPS-NKAQVKPGQ 140 >D17525-1|BAA04477.1| 699|Homo sapiens precursor of P100 serine protease of Ra-reactive factor protein. Length = 699 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 ++ T HP Y PN + +D+AL+ L+ + FV PICLP Sbjct: 535 VKHTTLHPKYDPNTFE--NDVALVELLESPVLNAFVMPICLP 574 >DQ314870-1|ABC40729.1| 406|Homo sapiens haptoglobin protein. Length = 406 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 233 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 274 >BC121125-1|AAI21126.1| 406|Homo sapiens haptoglobin protein. Length = 406 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 233 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 274 >BC121124-1|AAI21125.1| 347|Homo sapiens HP protein protein. Length = 347 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 174 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 215 >BC107587-1|AAI07588.1| 347|Homo sapiens HP protein protein. Length = 347 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 174 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 215 >BC070299-1|AAH70299.1| 281|Homo sapiens HP protein protein. Length = 281 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 108 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 149 >BC069331-1|AAH69331.1| 269|Homo sapiens elastase 2A protein. Length = 269 Score = 37.1 bits (82), Expect = 0.010 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N + +DIAL++L TD ++P CLP Sbjct: 102 VSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQPACLP 143 >BC058031-1|AAH58031.1| 228|Homo sapiens HP protein protein. Length = 228 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 55 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 96 >BC037775-1|AAH37775.1| 385|Homo sapiens testes-specific protease 50 protein. Length = 385 Score = 37.1 bits (82), Expect = 0.010 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 +DI L++L Y+++VRPICLP DY + R Sbjct: 205 NDIGLLKLKQELKYSNYVRPICLPGTDYVLKDHSR 239 >BC033016-1|AAH33016.1| 385|Homo sapiens testes-specific protease 50 protein. Length = 385 Score = 37.1 bits (82), Expect = 0.010 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 +DI L++L Y+++VRPICLP DY + R Sbjct: 205 NDIGLLKLKQELKYSNYVRPICLPGTDYVLKDHSR 239 >BC017862-1|AAH17862.1| 228|Homo sapiens HP protein protein. Length = 228 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 55 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 96 >AK222802-1|BAD96522.1| 487|Homo sapiens complement component 1, r subcomponent-like precursor variant protein. Length = 487 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLP 241 P+ + + HPDY N+ DIAL+ L + P V P+CLP Sbjct: 318 PVHRVVVHPDYRQNESHNFSGDIALLELQHSMPLGPNVLPVCLP 361 >AK024084-1|BAB14819.1| 438|Homo sapiens protein ( Homo sapiens cDNA FLJ14022 fis, clone HEMBA1003538, weakly similar to COMPLEMENT C1R COMPONENT PRECURSOR (EC 3.4.21.41). ). Length = 438 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLP 241 P+ + + HPDY N+ DIAL+ L + P V P+CLP Sbjct: 318 PVHRVVVHPDYRQNESHNFSGDIALLELQHSIPLGPNVLPVCLP 361 >AF178985-1|AAF44349.1| 487|Homo sapiens complement C1r-like proteinase precursor protein. Length = 487 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLP 241 P+ + + HPDY N+ DIAL+ L + P V P+CLP Sbjct: 318 PVHRVVVHPDYRQNESHNFSGDIALLELQHSIPLGPNVLPVCLP 361 >AF100707-1|AAF22500.1| 385|Homo sapiens testes-specific protein TSP50 protein. Length = 385 Score = 37.1 bits (82), Expect = 0.010 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 +DI L++L Y+++VRPICLP DY + R Sbjct: 205 NDIGLLKLKQELKYSNYVRPICLPGTDYVLKDHSR 239 >AC004682-3|AAC27432.1| 345|Homo sapiens haptoglobin protein. Length = 345 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS DY + Sbjct: 172 IEKVVLHPNY------SQVDIGLIKLKQKVSVNERVMPICLPSKDYAE 213 >M38193-1|AAA67124.1| 247|Homo sapiens cytotoxic T-lymphocyte-associated serine esterase 1 protein. Length = 247 Score = 36.7 bits (81), Expect = 0.013 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A T V+P+ LPS + Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKRTRAVQPLRLPS-NKAQVKPGQ 140 >M17016-1|AAA36627.1| 247|Homo sapiens protein ( Human serine protease-like protein mRNA, complete cds. ). Length = 247 Score = 36.7 bits (81), Expect = 0.013 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A T V+P+ LPS + Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKRTRAVQPLRLPS-NKAQVKPGQ 140 >J04071-1|AAA52118.1| 247|Homo sapiens serine esterase protein. Length = 247 Score = 36.7 bits (81), Expect = 0.013 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A T V+P+ LPS + Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKRTRAVQPLRLPS-NKAQVKPGQ 140 >J03072-1|AAB59528.1| 247|Homo sapiens CTLA1 protein. Length = 247 Score = 36.7 bits (81), Expect = 0.013 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A T V+P+ LPS + Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKRTRAVQPLRLPS-NKAQVKPGQ 140 >BC030195-1|AAH30195.1| 247|Homo sapiens granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) protein. Length = 247 Score = 36.7 bits (81), Expect = 0.013 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A T V+P+ LPS + Q PG+ Sbjct: 90 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKRTRAVQPLRLPS-NKAQVKPGQ 140 >AY372494-1|AAR23323.1| 281|Homo sapiens endogenous granzyme B precursor protein. Length = 281 Score = 36.7 bits (81), Expect = 0.013 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A T V+P+ LPS + Q PG+ Sbjct: 124 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKRTRAVQPLRLPS-NKAQVKPGQ 174 >AY232654-1|AAP70244.1| 235|Homo sapiens granzyme B variant protein. Length = 235 Score = 36.7 bits (81), Expect = 0.013 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 113 PIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 P+++ IPHP Y P + +DI L++L A T V+P+ LPS + Q PG+ Sbjct: 78 PVKRPIPHPAYNPKNFS--NDIMLLQLERKAKRTRAVQPLRLPS-NKAQVKPGQ 128 >BC040887-1|AAH40887.1| 260|Homo sapiens kallikrein-related peptidase 8 protein. Length = 260 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >AY359036-1|AAQ89395.1| 260|Homo sapiens KLK8 protein. Length = 260 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >AF243527-9|AAG33361.1| 260|Homo sapiens neuropsin protein. Length = 260 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >AF095743-1|AAD29574.1| 260|Homo sapiens serine protease ovasin protein. Length = 260 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >AF095742-1|AAD25979.1| 260|Homo sapiens serine protease ovasin protein. Length = 260 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >AF055982-1|AAD56050.1| 260|Homo sapiens serine protease TADG14 protein. Length = 260 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >AC011473-1|AAG23254.1| 164|Homo sapiens kallikrein 8 (neuropsin/ovasin) [amino acids 1-164] protein. Length = 164 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >AB012761-1|BAA28676.1| 164|Homo sapiens neuropsin protein. Length = 164 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >AB009849-1|BAA28673.1| 260|Homo sapiens neuropsin protein. Length = 260 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >AB008927-1|BAA82666.1| 305|Homo sapiens neuropsin type2 protein. Length = 305 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 139 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 193 >AB008390-1|BAA82665.1| 260|Homo sapiens neuropsin type1 protein. Length = 260 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQG-RHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P P+ ++IPHP Y +DV+ HD+ L++L A V+PI L D+ QP Sbjct: 94 PEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL--ADHCTQP 148 >BX537945-1|CAD97913.1| 416|Homo sapiens hypothetical protein protein. Length = 416 Score = 35.1 bits (77), Expect = 0.041 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQGRHD-IALIRLMVTAPYTDFVRPICLP 241 P +T ++ I H +Y G HD IAL++L +T+++R ICLP Sbjct: 247 PYMTRKVQNIIFHENY---SSPGLHDDIALVQLAEEVSFTEYIRKICLP 292 >BC126195-1|AAI26196.1| 416|Homo sapiens transmembrane protease, serine 11B protein. Length = 416 Score = 35.1 bits (77), Expect = 0.041 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQGRHD-IALIRLMVTAPYTDFVRPICLP 241 P +T ++ I H +Y G HD IAL++L +T+++R ICLP Sbjct: 247 PYMTRKVQNIIFHENY---SSPGLHDDIALVQLAEEVSFTEYIRKICLP 292 >BC048112-1|AAH48112.1| 348|Homo sapiens transmembrane protease, serine 12 protein. Length = 348 Score = 35.1 bits (77), Expect = 0.041 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 I+ I HP++I +DIAL L Y D+++PICLP Sbjct: 154 IKAIIIHPNFILESYV--NDIALFHLKKAVRYNDYIQPICLP 193 >BC035123-1|AAH35123.1| 320|Homo sapiens TMPRSS12 protein protein. Length = 320 Score = 35.1 bits (77), Expect = 0.041 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 I+ I HP++I +DIAL L Y D+++PICLP Sbjct: 154 IKAIIIHPNFILESYV--NDIALFHLKKAVRYNDYIQPICLP 193 >AL833167-1|CAD91168.1| 416|Homo sapiens hypothetical protein protein. Length = 416 Score = 35.1 bits (77), Expect = 0.041 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQGRHD-IALIRLMVTAPYTDFVRPICLP 241 P +T ++ I H +Y G HD IAL++L +T+++R ICLP Sbjct: 247 PYMTRKVQNIIFHENY---SSPGLHDDIALVQLAEEVSFTEYIRKICLP 292 >V00595-1|CAA23842.1| 615|Homo sapiens protein ( Homo sapiens mRNA for prothrombin. ). Length = 615 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 +EK HP Y + R DIAL++L ++D++ P+CLP Sbjct: 437 LEKIYIHPRYNWRENLDR-DIALMKLKKPVAFSDYIHPVCLP 477 >M17262-1|AAC63054.1| 622|Homo sapiens prothrombin protein. Length = 622 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 +EK HP Y + R DIAL++L ++D++ P+CLP Sbjct: 444 LEKIYIHPRYNWRENLDR-DIALMKLKKPVAFSDYIHPVCLP 484 >M13232-2|AAA88041.1| 444|Homo sapiens protein ( Human factor VII serine protease precursor mRNA, complete cds, clone lambda-HVII2463. ). Length = 444 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 272 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 309 >M13232-1|AAA88040.1| 466|Homo sapiens coagulation factor VII protein. Length = 466 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 294 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 331 >J02933-1|AAA51983.1| 466|Homo sapiens protein ( Human blood coagulation factor VII gene, complete cds. ). Length = 466 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 294 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 331 >EF421855-1|ABN79862.1| 273|Homo sapiens coagulation factor VII protein. Length = 273 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 101 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 138 >DQ142911-1|ABD17891.1| 466|Homo sapiens cogulation factor VII protein. Length = 466 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 294 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 331 >BC130468-1|AAI30469.1| 444|Homo sapiens coagulation factor VII (serum prothrombin conversion accelerator) protein. Length = 444 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 272 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 309 >BC051332-1|AAH51332.1| 622|Homo sapiens coagulation factor II (thrombin) protein. Length = 622 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 +EK HP Y + R DIAL++L ++D++ P+CLP Sbjct: 444 LEKIYIHPRYNWRENLDR-DIALMKLKKPVAFSDYIHPVCLP 484 >AY344794-1|AAR08143.1| 259|Homo sapiens prothrombin B-chain protein. Length = 259 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 +EK HP Y + R DIAL++L ++D++ P+CLP Sbjct: 81 LEKIYIHPRYNWRENLDR-DIALMKLKKPVAFSDYIHPVCLP 121 >AY344793-1|AAR08142.1| 295|Homo sapiens prothrombin protein. Length = 295 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 +EK HP Y + R DIAL++L ++D++ P+CLP Sbjct: 117 LEKIYIHPRYNWRENLDR-DIALMKLKKPVAFSDYIHPVCLP 157 >AY212252-1|AAP33841.1| 466|Homo sapiens FVII coagulation protein protein. Length = 466 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 294 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 331 >AL137002-10|CAI41381.1| 466|Homo sapiens coagulation factor VII (serum prothrombin conversion accelerator) protein. Length = 466 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 294 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 331 >AL137002-9|CAI41382.1| 444|Homo sapiens coagulation factor VII (serum prothrombin conversion accelerator) protein. Length = 444 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 272 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 309 >AK222777-1|BAD96497.1| 622|Homo sapiens coagulation factor II precursor variant protein. Length = 622 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 +EK HP Y + R DIAL++L ++D++ P+CLP Sbjct: 444 LEKIYIHPRYNWRENLDR-DIALMKLKKPVAFSDYIHPVCLP 484 >AK222775-1|BAD96495.1| 622|Homo sapiens coagulation factor II precursor variant protein. Length = 622 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 +EK HP Y + R DIAL++L ++D++ P+CLP Sbjct: 444 LEKIYIHPRYNWRENLDR-DIALMKLKKPVAFSDYIHPVCLP 484 >AJ972449-1|CAJ01369.1| 622|Homo sapiens prothrombin protein. Length = 622 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 +EK HP Y + R DIAL++L ++D++ P+CLP Sbjct: 444 LEKIYIHPRYNWRENLDR-DIALMKLKKPVAFSDYIHPVCLP 484 >AF478696-1|AAL77436.1| 622|Homo sapiens coagulation factor II (thrombin) protein. Length = 622 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 +EK HP Y + R DIAL++L ++D++ P+CLP Sbjct: 444 LEKIYIHPRYNWRENLDR-DIALMKLKKPVAFSDYIHPVCLP 484 >AF466933-1|AAL66184.1| 466|Homo sapiens coagulation factor VII (serum prothrombin conversion accelerator) protein. Length = 466 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 294 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 331 >AF272774-1|AAK58686.2| 679|Homo sapiens factor VII active site mutant immunoconjugate protein. Length = 679 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 143 YIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 Y+P HDIAL+RL TD V P+CLP ++++ Sbjct: 272 YVPGTTN--HDIALLRLHQPVVLTDHVVPLCLPERTFSER 309 >J00136-1|AAA98726.1| 462|Homo sapiens factor IX protein. Length = 462 Score = 33.9 bits (74), Expect = 0.095 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 I IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 297 IRAIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 343 >BC110451-1|AAI10452.1| 1042|Homo sapiens corin, serine peptidase protein. Length = 1042 Score = 33.9 bits (74), Expect = 0.095 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +2 Query: 77 GTKDCAHPVV---TAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSL 247 G + HP V T ++ I HP Y V +DI+++ L T +VRP+CLP+ Sbjct: 859 GINNLDHPSVFMQTRFVKTIILHPRYSRAVVD--YDISIVELSEDISETGYVRPVCLPNP 916 Query: 248 DYTQQP 265 + +P Sbjct: 917 EQWLEP 922 >BC074847-1|AAH74847.1| 454|Homo sapiens transmembrane protease, serine 3 protein. Length = 454 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 280 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 327 >BC074846-1|AAH74846.1| 453|Homo sapiens transmembrane protease, serine 3 protein. Length = 453 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 280 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 327 >BC011703-1|AAH11703.1| 437|Homo sapiens transmembrane protease, serine 4 protein. Length = 437 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +DIAL++L ++ VRPICLP D P W Sbjct: 289 NDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLW 325 >BC004855-1|AAH04855.1| 335|Homo sapiens transmembrane protease, serine 4 protein. Length = 335 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +DIAL++L ++ VRPICLP D P W Sbjct: 287 NDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLW 323 >AY633572-1|AAT66641.1| 538|Homo sapiens transmembrane protease serine 3 isoform 5 protein. Length = 538 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 364 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 411 >AY358530-1|AAQ88894.1| 432|Homo sapiens TMPRSS3 protein. Length = 432 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +DIAL++L ++ VRPICLP D P W Sbjct: 284 NDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLW 320 >AY358458-1|AAQ88823.1| 453|Homo sapiens ECHOS1 protein. Length = 453 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 280 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 327 >AK172842-1|BAD18806.1| 453|Homo sapiens protein ( Homo sapiens cDNA FLJ24003 fis, clone KAT00786, highly similar to Transmembrane protease, serine 3 (EC 3.4.21.-). ). Length = 453 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 280 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 327 >AK172766-1|BAD18749.1| 437|Homo sapiens protein ( Homo sapiens cDNA FLJ23927 fis, clone COL05059, highly similar to Transmembrane protease, serine 4 (EC 3.4.21.-). ). Length = 437 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +DIAL++L ++ VRPICLP D P W Sbjct: 289 NDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLW 325 >AK131212-1|BAD18402.1| 211|Homo sapiens protein ( Homo sapiens cDNA FLJ16093 fis, clone PROST2000452, moderately similar to TRANSMEMBRANE PROTEASE, SERINE 2 (EC 3.4.21.-). ). Length = 211 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 38 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 85 >AJ544583-1|CAD67566.1| 293|Homo sapiens testis serine protease 2 precursor protein. Length = 293 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/59 (25%), Positives = 30/59 (50%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 V +++ HP + R+D+AL++L +T ++PIC+P ++ + R W Sbjct: 144 VVVSVQRAFVHPKF-STVTTIRNDLALLQLQHPVNFTSNIQPICIPQENFQVEGRTRCW 201 >AF216312-1|AAF31436.1| 423|Homo sapiens type II membrane serine protease protein. Length = 423 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +DIAL++L ++ VRPICLP D P W Sbjct: 275 NDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLW 311 >AF201380-1|AAG37012.1| 455|Homo sapiens serine protease TADG12 protein. Length = 455 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 281 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 328 >AF179224-1|AAF74526.1| 437|Homo sapiens transmembrane serine protease 3 protein. Length = 437 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 +DIAL++L ++ VRPICLP D P W Sbjct: 289 NDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLW 325 >AF133845-1|AAD31850.1| 1042|Homo sapiens corin protein. Length = 1042 Score = 33.9 bits (74), Expect = 0.095 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +2 Query: 77 GTKDCAHPVV---TAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSL 247 G + HP V T ++ I HP Y V +DI+++ L T +VRP+CLP+ Sbjct: 859 GINNLDHPSVFMQTRFVKTIILHPRYSRAVVD--YDISIVELSEDISETGYVRPVCLPNP 916 Query: 248 DYTQQP 265 + +P Sbjct: 917 EQWLEP 922 >AB038159-1|BAB20079.1| 327|Homo sapiens serine protease protein. Length = 327 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 153 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 200 >AB038158-1|BAB20078.1| 327|Homo sapiens serine protease protein. Length = 327 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 153 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 200 >AB038157-1|BAB20077.1| 454|Homo sapiens serine protease protein. Length = 454 Score = 33.9 bits (74), Expect = 0.095 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 95 HPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 +P + +EK + H Y P + +DIAL++L + + ++P+CLP+ Sbjct: 280 NPAPSHLVEKIVYHSKYKPKRLG--NDIALMKLAGPLTFNEMIQPVCLPN 327 >X89214-1|CAA61501.1| 385|Homo sapiens haptoglobin-related protein protein. Length = 385 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS +Y + Sbjct: 212 IEKVVLHPNY------HQVDIGLIKLKQKVLVNERVMPICLPSKNYAE 253 >X75363-1|CAA53145.1| 225|Homo sapiens serine protease homologue protein. Length = 225 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQ 262 + IPHP Y + R+DI L+RL+ A VRP C P + T++ Sbjct: 22 RVIPHPRY---EASHRNDIMLLRLVQPARLNPQVRPGCYPRVAPTRE 65 >X06290-1|CAA29618.1| 4548|Homo sapiens protein ( Human mRNA for apolipoprotein(a). ). Length = 4548 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLPSLDY 253 DIAL++L A TD V P CLPS DY Sbjct: 4412 DIALLKLSRPAVITDKVMPACLPSPDY 4438 >M69197-2|AAA88079.1| 348|Homo sapiens haptoglobin-related protein protein. Length = 348 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS +Y + Sbjct: 175 IEKVVLHPNY------HQVDIGLIKLKQKVLVNERVMPICLPSKNYAE 216 >M19063-1|AAA52456.1| 70|Homo sapiens F9 protein. Length = 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 9 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 53 >M16653-1|AAA52381.1| 269|Homo sapiens ELA1 protein. Length = 269 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N V +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQVSKGNDIALLKLANPVSLTDKIQLACLP 143 >M11309-1|AAA52023.1| 461|Homo sapiens F9 protein. Length = 461 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 342 >K03431-1|AAA88081.1| 348|Homo sapiens haptoglobin-related protein protein. Length = 348 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS +Y + Sbjct: 175 IEKVVLHPNY------HQVDIGLIKLKQKVLVNERVMPICLPSKNYAE 216 >K02402-1|AAB59620.1| 461|Homo sapiens factor IX protein. Length = 461 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 342 >K02053-1|AAA56822.1| 461|Homo sapiens protein ( Human factor IX gene, exons 7 and 8. ). Length = 461 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 342 >J00137-1|AAA52763.1| 461|Homo sapiens F9 protein. Length = 461 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 342 >DQ452068-1|ABF47086.1| 2040|Homo sapiens lipoprotein, Lp(a) protein. Length = 2040 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLPSLDY 253 DIAL++L A TD V P CLPS DY Sbjct: 1904 DIALLKLSRPAVITDKVMPACLPSPDY 1930 >DQ431840-1|ABF69029.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431839-1|ABF69028.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431838-1|ABF69027.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431837-1|ABF69026.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431836-1|ABF69025.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431835-1|ABF69024.1| 181|Homo sapiens coagulation factor IX protein. Length = 181 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431834-1|ABF69023.1| 181|Homo sapiens coagulation factor IX protein. Length = 181 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431833-1|ABF69022.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431832-1|ABF69021.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431831-1|ABF69020.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431830-1|ABF69019.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431829-1|ABF69018.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431828-1|ABF69017.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431827-1|ABF69016.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431826-1|ABF69015.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431825-1|ABF69014.1| 99|Homo sapiens truncated coagulation factor IX protein. Length = 99 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431824-1|ABF69013.1| 99|Homo sapiens truncated coagulation factor IX protein. Length = 99 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431823-1|ABF69012.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431822-1|ABF69011.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431821-1|ABF69010.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431816-1|ABF69005.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >DQ431811-1|ABF69000.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 63 >BC113542-1|AAI13543.1| 269|Homo sapiens elastase 2B protein. Length = 269 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N V +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQVSKGNDIALLKLANPVSLTDKIQLACLP 143 >BC113540-1|AAI13541.1| 269|Homo sapiens elastase 2B protein. Length = 269 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N V +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQVSKGNDIALLKLANPVSLTDKIQLACLP 143 >BC113414-1|AAI13415.1| 423|Homo sapiens transmembrane protease, serine 11E protein. Length = 423 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 +DI+L L PYT+ V +CLP Y QP Sbjct: 276 YDISLAELSSPVPYTNAVHRVCLPDASYEFQP 307 >BC113412-1|AAI13413.1| 423|Homo sapiens transmembrane protease, serine 11E protein. Length = 423 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 +DI+L L PYT+ V +CLP Y QP Sbjct: 276 YDISLAELSSPVPYTNAVHRVCLPDASYEFQP 307 >BC109215-1|AAI09216.1| 461|Homo sapiens F9 protein protein. Length = 461 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 342 >BC109214-1|AAI09215.1| 461|Homo sapiens F9 protein protein. Length = 461 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 342 >AY359017-1|AAQ89376.1| 423|Homo sapiens serine protease protein. Length = 423 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 +DI+L L PYT+ V +CLP Y QP Sbjct: 276 YDISLAELSSPVPYTNAVHRVCLPDASYEFQP 307 >AL596089-1|CAH73590.1| 2040|Homo sapiens lipoprotein, Lp(a) protein. Length = 2040 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLPSLDY 253 DIAL++L A TD V P CLPS DY Sbjct: 1904 DIALLKLSRPAVITDKVMPACLPSPDY 1930 >AL109933-1|CAI22905.1| 2040|Homo sapiens lipoprotein, Lp(a) protein. Length = 2040 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLPSLDY 253 DIAL++L A TD V P CLPS DY Sbjct: 1904 DIALLKLSRPAVITDKVMPACLPSPDY 1930 >AL033403-1|CAI42103.1| 461|Homo sapiens coagulation factor IX (plasma thromboplastic component, Christmas disease, hemo protein. Length = 461 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 342 >AF536327-1|AAM96188.1| 461|Homo sapiens coagulation factor IX (plasma thromboplastic component, Christmas disease, hemo protein. Length = 461 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 342 >AF113248-1|AAF21966.1| 307|Homo sapiens heart specific serine proteinase protein. Length = 307 Score = 33.5 bits (73), Expect = 0.13 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +2 Query: 77 GTKDCAHPVV---TAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSL 247 G + HP V T + I HP Y V +DI+++ L T +VRP+CLP+ Sbjct: 126 GINNLDHPSVFMQTRFVRTIILHPRYSRAVVD--YDISIVELSEDISETGYVRPVCLPNP 183 Query: 248 DYTQQP 265 + +P Sbjct: 184 EQWLEP 189 >AF064819-1|AAF04328.1| 422|Homo sapiens serine protease DESC1 protein. Length = 422 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 +DI+L L PYT+ V +CLP Y QP Sbjct: 275 YDISLAELSSPVPYTNAVHRVCLPDASYEFQP 306 >AC079749-1|AAY40995.1| 419|Homo sapiens unknown protein. Length = 419 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 +DI+L L PYT+ V +CLP Y QP Sbjct: 272 YDISLAELSSPVPYTNAVHRVCLPDASYEFQP 303 >AC004682-2|AAC27433.1| 346|Homo sapiens haptoglobin-related protein precursor protein. Length = 346 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI LI+L + V PICLPS +Y + Sbjct: 173 IEKVVLHPNY------HQVDIGLIKLKQKVLVNERVMPICLPSKNYAE 214 >AB186358-1|BAD89383.1| 423|Homo sapiens coagulation factor IX protein. Length = 423 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL+ L +V PIC+ +YT Sbjct: 260 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYT 304 >M16652-1|AAA52380.1| 269|Homo sapiens ELA1 protein. Length = 269 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N + +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLP 143 >M16631-1|AAA52374.1| 269|Homo sapiens ELA1 protein. Length = 269 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N + +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLP 143 >D00236-1|BAA00165.1| 269|Homo sapiens pancreatic elastase 2 precursor protein. Length = 269 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N + +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLP 143 >CR450291-1|CAG29287.1| 269|Homo sapiens ELA2A protein. Length = 269 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N + +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLP 143 >BC069432-1|AAH69432.1| 269|Homo sapiens elastase 2A protein. Length = 269 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N + +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLP 143 >BC060513-1|AAH60513.1| 810|Homo sapiens plasminogen protein. Length = 810 Score = 33.1 bits (72), Expect = 0.17 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLPSLDY 253 R DIAL++L A TD V P CLPS +Y Sbjct: 663 RKDIALLKLSSPADITDKVIPACLPSPNY 691 >BC007031-1|AAH07031.1| 269|Homo sapiens elastase 2A protein. Length = 269 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N + +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLP 143 >AY358524-1|AAQ88888.1| 248|Homo sapiens KLK12 protein. Length = 248 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 125 TIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ HP Y+ HD+ L+RL + T V+P+ LP+ Sbjct: 92 SVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPN 131 >AL512883-1|CAC42421.1| 269|Homo sapiens elastase 2A (ELA2A) protein. Length = 269 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ N + +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLP 143 >AF243527-13|AAG33365.1| 248|Homo sapiens kallikrein-like 5 protein. Length = 248 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 125 TIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ HP Y+ HD+ L+RL + T V+P+ LP+ Sbjct: 92 SVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPN 131 >AF135025-2|AAD26426.2| 248|Homo sapiens kallikrein-like protein 5 protein. Length = 248 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 125 TIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ HP Y+ HD+ L+RL + T V+P+ LP+ Sbjct: 92 SVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPN 131 >AF135025-1|AAF06065.1| 254|Homo sapiens kallikrein-like protein 5-related protein 1 protein. Length = 254 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 125 TIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ HP Y+ HD+ L+RL + T V+P+ LP+ Sbjct: 92 SVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPN 131 >AC011473-5|AAG23258.1| 254|Homo sapiens kallikrein 12 protein. Length = 254 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 125 TIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPS 244 ++ HP Y+ HD+ L+RL + T V+P+ LP+ Sbjct: 92 SVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPN 131 >X05199-1|CAA28831.1| 810|Homo sapiens protein ( Human mRNA for plasminogen. ). Length = 810 Score = 32.7 bits (71), Expect = 0.22 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLPSLDY 253 R DIAL++L A TD V P CLPS +Y Sbjct: 663 RKDIALLKLSSPAVITDKVIPACLPSPNY 691 >X01794-1|CAA25927.1| 348|Homo sapiens haptoglobin protein. Length = 348 Score = 32.7 bits (71), Expect = 0.22 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQ 259 IEK + HP+Y + DI +I+L + V PICLPS +Y + Sbjct: 175 IEKVVLHPNY------HQVDIGIIKLKQKVLVNERVMPICLPSKNYAE 216 >M74220-1|AAA36451.1| 810|Homo sapiens plasminogen protein. Length = 810 Score = 32.7 bits (71), Expect = 0.22 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLPSLDY 253 R DIAL++L A TD V P CLPS +Y Sbjct: 663 RKDIALLKLSSPAVITDKVIPACLPSPNY 691 >M34276-1|AAA60113.1| 810|Homo sapiens plasminogen protein. Length = 810 Score = 32.7 bits (71), Expect = 0.22 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLPSLDY 253 R DIAL++L A TD V P CLPS +Y Sbjct: 663 RKDIALLKLSSPAVITDKVIPACLPSPNY 691 >K02922-1|AAA60124.1| 519|Homo sapiens PLG protein. Length = 519 Score = 32.7 bits (71), Expect = 0.22 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLPSLDY 253 R DIAL++L A TD V P CLPS +Y Sbjct: 372 RKDIALLKLSSPAVITDKVIPACLPSPNY 400 >BC126137-1|AAI26138.1| 256|Homo sapiens kallikrein-related peptidase 15 protein. Length = 256 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 70 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 115 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 116 ARLNPQVRPAVLPT 129 >BC121109-1|AAI21110.1| 328|Homo sapiens ESSPL protein protein. Length = 328 Score = 32.7 bits (71), Expect = 0.22 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 + K + HP Y D D+AL++L +T + PICLPS+ P W Sbjct: 99 VSKIVIHPKY--QDTTA--DVALLKLSSQVTFTSAILPICLPSVTKQLAIPPFCW 149 >BC069518-1|AAH69518.1| 255|Homo sapiens kallikrein-related peptidase 15 protein. Length = 255 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 69 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 114 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 115 ARLNPQVRPAVLPT 128 >BC069507-1|AAH69507.1| 256|Homo sapiens kallikrein-related peptidase 15 protein. Length = 256 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 70 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 115 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 116 ARLNPQVRPAVLPT 129 >BC069480-1|AAH69480.1| 255|Homo sapiens kallikrein-related peptidase 15 protein. Length = 255 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 69 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 114 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 115 ARLNPQVRPAVLPT 128 >BC034294-1|AAH34294.1| 290|Homo sapiens protease, serine 27 protein. Length = 290 Score = 32.7 bits (71), Expect = 0.22 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLP 241 D+AL+ L P+T+++ P+CLP Sbjct: 124 DVALVELEAPVPFTNYILPVCLP 146 >AY373374-1|AAQ82621.1| 162|Homo sapiens kallikrein 15 isoform 6 preproprotein protein. Length = 162 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 70 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 115 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 116 ARLNPQVRPAVLPT 129 >AY373373-1|AAQ82620.1| 162|Homo sapiens kallikrein 15 isoform 5 preproprotein protein. Length = 162 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 70 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 115 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 116 ARLNPQVRPAVLPT 129 >AY359106-1|AAQ89464.1| 290|Homo sapiens MPN protein. Length = 290 Score = 32.7 bits (71), Expect = 0.22 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLP 241 D+AL+ L P+T+++ P+CLP Sbjct: 124 DVALVELEAPVPFTNYILPVCLP 146 >AY192161-1|AAN85555.1| 810|Homo sapiens plasminogen protein. Length = 810 Score = 32.7 bits (71), Expect = 0.22 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLPSLDY 253 R DIAL++L A TD V P CLPS +Y Sbjct: 663 RKDIALLKLSSPAVITDKVIPACLPSPNY 691 >AY030095-1|AAK38168.1| 290|Homo sapiens pancreasin protein. Length = 290 Score = 32.7 bits (71), Expect = 0.22 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLP 241 D+AL+ L P+T+++ P+CLP Sbjct: 124 DVALVELEAPVPFTNYILPVCLP 146 >AL109933-5|CAI22908.1| 810|Homo sapiens plasminogen protein. Length = 810 Score = 32.7 bits (71), Expect = 0.22 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 167 RHDIALIRLMVTAPYTDFVRPICLPSLDY 253 R DIAL++L A TD V P CLPS +Y Sbjct: 663 RKDIALLKLSSPAVITDKVIPACLPSPNY 691 >AJ306593-1|CAC35467.1| 290|Homo sapiens marapsin protein. Length = 290 Score = 32.7 bits (71), Expect = 0.22 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLP 241 D+AL+ L P+T+++ P+CLP Sbjct: 124 DVALVELEAPVPFTNYILPVCLP 146 >AF303046-1|AAK62813.1| 255|Homo sapiens prostinogen protein. Length = 255 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 69 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 114 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 115 ARLNPQVRPAVLPT 128 >AF243527-2|AAG33354.1| 247|Homo sapiens ACO protease protein. Length = 247 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 70 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 115 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 116 ARLNPQVRPAVLPT 129 >AF242195-3|AAG09471.1| 161|Homo sapiens KLK15 splice variant 2 protein. Length = 161 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 70 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 115 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 116 ARLNPQVRPAVLPT 129 >AF242195-1|AAG09469.1| 256|Homo sapiens KLK15 protein. Length = 256 Score = 32.7 bits (71), Expect = 0.22 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 VRLGEYNTTN-NGPDCMKGTKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVT 202 VRLGE+N +GP+ ++ T + IPHP Y R+DI L+RL+ Sbjct: 70 VRLGEHNLRKRDGPEQLRTTS------------RVIPHPRYEARS--HRNDIMLLRLVQP 115 Query: 203 APYTDFVRPICLPS 244 A VRP LP+ Sbjct: 116 ARLNPQVRPAVLPT 129 >AB056161-1|BAB85497.1| 290|Homo sapiens serine protease 27 protein. Length = 290 Score = 32.7 bits (71), Expect = 0.22 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 173 DIALIRLMVTAPYTDFVRPICLP 241 D+AL+ L P+T+++ P+CLP Sbjct: 124 DVALVELEAPVPFTNYILPVCLP 146 >BC009726-1|AAH09726.1| 317|Homo sapiens protease, serine, 22 protein. Length = 317 Score = 31.9 bits (69), Expect = 0.38 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +2 Query: 131 PHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 PHP Y + DIAL+RL + +++ V PICLP P W Sbjct: 128 PHPVYSWKE-GACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCW 176 >AY358396-1|AAQ88762.1| 334|Homo sapiens PRSS22 protein. Length = 334 Score = 31.9 bits (69), Expect = 0.38 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +2 Query: 131 PHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 PHP Y + DIAL+RL + +++ V PICLP P W Sbjct: 145 PHPVYSWKE-GACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCW 193 >AF321182-1|AAG35070.1| 317|Homo sapiens serine protease PRSS22 protein. Length = 317 Score = 31.9 bits (69), Expect = 0.38 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +2 Query: 131 PHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 PHP Y + DIAL+RL + +++ V PICLP P W Sbjct: 128 PHPVYSWKE-GACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCW 176 >AC003965-1|AAB93671.1| 271|Homo sapiens SP001LA protein. Length = 271 Score = 31.9 bits (69), Expect = 0.38 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +2 Query: 131 PHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 PHP Y + DIAL+RL + +++ V PICLP P W Sbjct: 82 PHPVYSWKE-GACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCW 130 >AB010779-1|BAB20263.1| 317|Homo sapiens brain-specific serine protease-4 protein. Length = 317 Score = 31.9 bits (69), Expect = 0.38 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +2 Query: 131 PHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGRFW 280 PHP Y + DIAL+RL + +++ V PICLP P W Sbjct: 128 PHPVYSWKE-GACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCW 176 >DQ431820-1|ABF69009.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 31.5 bits (68), Expect = 0.51 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDY 253 + IPH +Y + HDIAL+ L +V PIC+ +Y Sbjct: 19 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEY 62 >DQ431818-1|ABF69007.1| 182|Homo sapiens coagulation factor IX protein. Length = 182 Score = 31.5 bits (68), Expect = 0.51 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +2 Query: 122 KTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYT 256 + IPH +Y + HDIAL L +V PIC+ +YT Sbjct: 19 RIIPHHNYNAAINKYNHDIALRELDEPLVLNSYVTPICIADKEYT 63 >BC069455-1|AAH69455.1| 269|Homo sapiens elastase 2B protein. Length = 269 Score = 31.5 bits (68), Expect = 0.51 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ + V +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSDQVSKGNDIALLKLANPVSLTDKIQLACLP 143 >BC069412-1|AAH69412.1| 269|Homo sapiens elastase 2B protein. Length = 269 Score = 31.5 bits (68), Expect = 0.51 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ + V +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSDQVSKGNDIALLKLANPVSLTDKIQLACLP 143 >AY498712-1|AAS78642.1| 417|Homo sapiens epidermal type II transmembrane serine protease protein. Length = 417 Score = 31.5 bits (68), Expect = 0.51 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P++ + + I H Y +DIA++++ ++D +R ICLP + QP Sbjct: 248 PLMKRNVRRFIIHEKY--RSAAREYDIAVVQVSSRVTFSDDIRQICLPEASASFQP 301 >AL512883-2|CAC42422.1| 269|Homo sapiens pancreatic elastase IIB (ELA2B) protein. Length = 269 Score = 31.5 bits (68), Expect = 0.51 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 + K + H D+ + V +DIAL++L TD ++ CLP Sbjct: 102 VSKIVVHKDWNSDQVSKGNDIALLKLANPVSLTDKIQLACLP 143 >AJ488947-1|CAD35759.1| 855|Homo sapiens polyserase-IB protein protein. Length = 855 Score = 31.5 bits (68), Expect = 0.51 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 V A + + + HP Y N D+A++ L P+ ++P+CLP+ + P Sbjct: 271 VRAQVVQIVKHPLY--NADTADFDVAVLELTSPLPFGRHIQPVCLPAATHIFPP 322 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 + + + HP Y P + D+A++ L + +++P+CLP L + P GR Sbjct: 575 LRRVVLHPLYNPGILD--FDLAVLELASPLAFNKYIQPVCLP-LAIQKFPVGR 624 >AJ488946-1|CAD35758.1| 1059|Homo sapiens polyserase-IA protein protein. Length = 1059 Score = 31.5 bits (68), Expect = 0.51 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 V A + + + HP Y N D+A++ L P+ ++P+CLP+ + P Sbjct: 271 VRAQVVQIVKHPLY--NADTADFDVAVLELTSPLPFGRHIQPVCLPAATHIFPP 322 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPGR 274 + + + HP Y P + D+A++ L + +++P+CLP L + P GR Sbjct: 575 LRRVVLHPLYNPGILD--FDLAVLELASPLAFNKYIQPVCLP-LAIQKFPVGR 624 >AB109390-1|BAF02295.1| 531|Homo sapiens Serase-1B protein. Length = 531 Score = 31.5 bits (68), Expect = 0.51 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +2 Query: 104 VTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 V A + + + HP Y N D+A++ L P+ ++P+CLP+ + P Sbjct: 305 VRAQVVQIVKHPLY--NADTADFDVAVLELTSPLPFGRHIQPVCLPAATHIFPP 356 >BC111796-1|AAI11797.1| 418|Homo sapiens TMPRSS11A protein protein. Length = 418 Score = 31.1 bits (67), Expect = 0.67 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P++ + + I H Y +DIA++++ ++D +R ICLP + QP Sbjct: 249 PLMKRNVRRFIIHEKY--RSAAREYDIAVVQVSSRVTFSDDIRRICLPEASASFQP 302 >AL844853-12|CAI41860.1| 764|Homo sapiens B-factor, properdin protein. Length = 764 Score = 31.1 bits (67), Expect = 0.67 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 7/54 (12%) Frame = +2 Query: 116 IEKTIPHPDYIPNDVQGR-------HDIALIRLMVTAPYTDFVRPICLPSLDYT 256 IE + HP+Y N + +D+ALI+L Y +RPICLP + T Sbjct: 550 IEVVLFHPNYNINGKEEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGT 603 >AK131518-1|BAD18660.1| 421|Homo sapiens protein ( Homo sapiens cDNA FLJ16745 fis, clone CTONG2016942, weakly similar to Homo sapiens serine protease DESC1 (DESC1) mRNA. ). Length = 421 Score = 31.1 bits (67), Expect = 0.67 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLPSLDYTQQP 265 P++ + + I H Y +DIA++++ ++D +R ICLP + QP Sbjct: 252 PLMKRNVRRFIIHEKY--RSAAREYDIAVVQVSSRVTFSDDIRRICLPEASASFQP 305 >AK122625-1|BAC85495.1| 438|Homo sapiens protein ( Homo sapiens cDNA FLJ16046 fis, clone CTONG2013178, weakly similar to Homo sapiens serine protease DESC1 (DESC1) mRNA. ). Length = 438 Score = 31.1 bits (67), Expect = 0.67 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +2 Query: 98 PVVTAPIEKTIPHPDYIPNDVQGRHDIALIRLMVTAPYTDFVRPICLP 241 P V + K I H +Y + +DIAL++L +++ V+ +CLP Sbjct: 270 PAVKRNVRKIILHENY--HRETNENDIALVQLSTGVEFSNIVQRVCLP 315 >X87904-1|CAB57277.1| 2135|Homo sapiens semaphorin receptor protein. Length = 2135 Score = 30.7 bits (66), Expect = 0.89 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 209 TVLLPSA**AQCHVCLAHRWGCN 141 T L PSA QC C++ RWGCN Sbjct: 633 TELRPSA---QCQACVSSRWGCN 652 >X72875-1|CAA51389.1| 764|Homo sapiens complement factor B protein. Length = 764 Score = 30.7 bits (66), Expect = 0.89 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYT 256 +D+ALI+L Y +RPICLP + T Sbjct: 575 YDVALIKLKNKLKYGQTIRPICLPCTEGT 603 >S67310-1|AAD13989.1| 764|Homo sapiens complement factor B protein. Length = 764 Score = 30.7 bits (66), Expect = 0.89 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 170 HDIALIRLMVTAPYTDFVRPICLPSLDYT 256 +D+ALI+L Y +RPICLP + T Sbjct: 575 YDVALIKLKNKLKYGQTIRPICLPCTEGT 603 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,667,146 Number of Sequences: 237096 Number of extensions: 1120929 Number of successful extensions: 2819 Number of sequences better than 10.0: 363 Number of HSP's better than 10.0 without gapping: 2715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2801 length of database: 76,859,062 effective HSP length: 74 effective length of database: 59,313,958 effective search space used: 1364221034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -