BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G09 (465 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4B4.09 |usp105|prp39|U1 snRNP-associated protein Usp105|Schi... 29 0.26 SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces ... 28 0.81 SPAC5D6.02c |mug165||sequence orphan|Schizosaccharomyces pombe|c... 27 1.1 SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pom... 27 1.4 SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizo... 25 4.3 SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 25 4.3 SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pomb... 25 5.7 SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosacchar... 25 5.7 SPCC4B3.16 |tip41||TIP41-like type 2a phosphatase regulator Tip4... 25 7.5 SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyce... 25 7.5 SPAC25A8.02 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 7.5 SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual 24 9.9 SPCC1827.08c |pof7|SPCC70.11c|F-box protein Pof7|Schizosaccharom... 24 9.9 SPBPB8B6.04c |grt1|SPAPB8B6.04c, SPAPB8B6.04c|transcription fact... 24 9.9 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 24 9.9 >SPBC4B4.09 |usp105|prp39|U1 snRNP-associated protein Usp105|Schizosaccharomyces pombe|chr 2|||Manual Length = 612 Score = 29.5 bits (63), Expect = 0.26 Identities = 20/69 (28%), Positives = 35/69 (50%) Frame = +2 Query: 44 LDIFEKTFVQSLQKGKFESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEI 223 L IF+K +++ ++ FES K+ FH ++ W++ D EEV D+QR + Sbjct: 247 LQIFQKVQLETAKRWTFESEIKRPYFHVKELDEAQLVNWRKYLDF--EEVEGDFQRICHL 304 Query: 224 VARHVLGAA 250 R ++ A Sbjct: 305 YERCLITCA 313 >SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 27.9 bits (59), Expect = 0.81 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +2 Query: 38 RFLDIFEKTFVQSLQKGKFESYG-KKID-FHDEKA 136 +FL+I+ +T + L G E G KK++ +HD KA Sbjct: 606 QFLEIYNETIIDLLASGNEEEKGKKKLEIYHDTKA 640 >SPAC5D6.02c |mug165||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 27.5 bits (58), Expect = 1.1 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (3%) Frame = +3 Query: 57 KRLSYSPYRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSL-- 230 K+L + K + + + +T+ R+ L +T + +C K+ + I DL+ SL Sbjct: 198 KQLDHFFSYKVTTVHKSYQRFATLLRRHLLDKTAKRYHDLCEKRPYKYITTDLLSPSLTC 257 Query: 231 -AMCSVQHLNHSTSTPSCPVRLTFT 302 A +Q + TS+ S PV L T Sbjct: 258 FASDILQTVPEYTSSQSSPVLLPAT 282 >SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 27.1 bits (57), Expect = 1.4 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 391 IRLQVMLECVKVTH-NPVI*LIECRVSKCGLVKVKRTGHEGVLVEWF 254 I Q L+ + TH NPV EC +S+C L K G E L + F Sbjct: 233 ILFQNALDALPTTHGNPV----ECDISRCPLNACKIAGQETELADLF 275 >SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 25.4 bits (53), Expect = 4.3 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 215 YEIVARHVLGAAPKPFDKHTFMPSALDFYQTALRD 319 Y +ARH L + FD HTF + FY T RD Sbjct: 183 YARLARHGLSEPSEMFDIHTFRENPEIFY-TFARD 216 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 25.4 bits (53), Expect = 4.3 Identities = 17/78 (21%), Positives = 28/78 (35%) Frame = +3 Query: 81 RKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQHLNH 260 RK R+ ++ + + L + IC Q I L + C L H Sbjct: 1063 RKIAHFESRRRYLTNLYEHIVLKAESHQICIICRDIIKQGFITTCGHLYCSFCLEAWLKH 1122 Query: 261 STSTPSCPVRLTFTKPHF 314 S+S P C +L ++ Sbjct: 1123 SSSCPMCKTKLNKNNAYY 1140 >SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 424 Score = 25.0 bits (52), Expect = 5.7 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 56 EKTFVQSLQKGKFESYGKKIDFHDEKAIN 142 EKT V+S+ K + + G DFH E A N Sbjct: 12 EKTHVESIVKFEDSNRGTITDFHIETANN 40 >SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosaccharomyces pombe|chr 3|||Manual Length = 902 Score = 25.0 bits (52), Expect = 5.7 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 249 HLNHSTSTPSCPVRLTF--TKPHFETLHSISYITGLWVTLT 365 HL S STPS LTF T + T H LW L+ Sbjct: 605 HLIDSISTPSVCTSLTFAPTGDYLATTHVDQVGISLWTNLS 645 >SPCC4B3.16 |tip41||TIP41-like type 2a phosphatase regulator Tip41|Schizosaccharomyces pombe|chr 3|||Manual Length = 252 Score = 24.6 bits (51), Expect = 7.5 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 128 EKAINFVGNYWQENADLYEEEVTKDYQRSYEIVARHVLG 244 +K +N N W L+E+E+ + + +++ AR V G Sbjct: 131 QKILNAGQNLWFNEIILFEDELADNGKSMFDVRARVVQG 169 >SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 24.6 bits (51), Expect = 7.5 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +2 Query: 5 NLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHDEKAINFVGNYWQENADLYE 184 NL+S + Y + + +++ S GK+ Y ++ + D + N G Y + N Y Sbjct: 161 NLNSQEFYGRVLNVQKAKRSRPHSPTPGKYMGYDRRRNSRDFPSNNKDGGYRRNN---YR 217 Query: 185 EEVTKDYQRSY 217 + + Y+ SY Sbjct: 218 DRDSNRYRNSY 228 >SPAC25A8.02 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 24.6 bits (51), Expect = 7.5 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +3 Query: 135 QLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQHLNHSTSTP-SCPVRL 293 +L S TI P+C++ K + +N L+L+ + L TS P CP++L Sbjct: 228 ELNASVTISG-IPVCIRSKEKMFLNPDCALTLSFICI-FLAQYTSIPLPCPLQL 279 >SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual Length = 4717 Score = 24.2 bits (50), Expect = 9.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 38 RFLDIFEKTFVQSLQKGKFES 100 RF+DIFE+TF S + KF S Sbjct: 528 RFIDIFEQTF-SSKKNAKFIS 547 >SPCC1827.08c |pof7|SPCC70.11c|F-box protein Pof7|Schizosaccharomyces pombe|chr 3|||Manual Length = 361 Score = 24.2 bits (50), Expect = 9.9 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +2 Query: 158 WQENADLYEEEVTKDYQRSYE 220 WQ++ EEE+ + YQ+S++ Sbjct: 170 WQQSIKSIEEELVEKYQQSWK 190 >SPBPB8B6.04c |grt1|SPAPB8B6.04c, SPAPB8B6.04c|transcription factor Grt1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 648 Score = 24.2 bits (50), Expect = 9.9 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +2 Query: 350 VGYLNAFKHYLKPYPREKLHFVGVXINDVVVEK 448 + ++N HYL+ R F+ ND+ E+ Sbjct: 96 ISFVNQLNHYLRKAERNGYDFLSEGQNDITPEE 128 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 24.2 bits (50), Expect = 9.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 302 QTALRDPAFYQLYYRIVGYLNAFKH 376 +TAL + F+Q YYR + LN H Sbjct: 277 KTALEEFNFWQFYYRSLSRLNDQLH 301 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,868,016 Number of Sequences: 5004 Number of extensions: 39032 Number of successful extensions: 142 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 176367270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -