BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G09 (465 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 29 1.4 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 1.9 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 27 5.8 SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) 27 7.7 SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_20479| Best HMM Match : Collagen (HMM E-Value=1) 27 7.7 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.47 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 228 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 320 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 29.5 bits (63), Expect = 1.4 Identities = 21/71 (29%), Positives = 32/71 (45%) Frame = +3 Query: 249 HLNHSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTLTHSSIT*SLILERNFISSAXKS 428 +L HST T S L T T +++++T + TLTH +IT S I Sbjct: 26 NLTHSTLTHSNLTHLNLTHSTL-TYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 429 MMLSLRN*SHS 461 + L+ +HS Sbjct: 85 LTLTYSTLTHS 95 Score = 28.3 bits (60), Expect = 3.3 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 2/84 (2%) Frame = +3 Query: 213 LMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTLTHSSIT*S 386 L L+L ++ HL +ST T S LT T H +++Y T TLTHS++T S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLT--HL----TLTYSTLTHSTLTHSTLTHS 105 Query: 387 LILERNFISSAXKSMMLSLRN*SH 458 + S L+ N +H Sbjct: 106 TLTHSTLTHSTITHSTLTHSNLTH 129 Score = 27.5 bits (58), Expect = 5.8 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 4/86 (4%) Frame = +3 Query: 216 MKLSLAMCSVQHLNHSTSTPSCPVRLTFTKP---HFETLH-SISYITGLWVTLTHSSIT* 383 + L+ + + L H T T S LT T H H +++++T + TLTHS++T Sbjct: 40 LNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTHLTLTYSTLTHSTLTH 99 Query: 384 SLILERNFISSAXKSMMLSLRN*SHS 461 S + S ++ +HS Sbjct: 100 STLTHSTLTHSTLTHSTITHSTLTHS 125 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -2 Query: 134 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRCVDC 3 P H NQ C IC+ G KS KCP L S RC C Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARCTLC 288 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 1.9 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +2 Query: 77 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 208 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 92 FESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEIVAR 232 FE Y ++ DEKA ++ Y ++ A + E +RSY + + Sbjct: 138 FEIYVSLNEWQDEKAGQYLAVYLKDEAKAFYHEQEDSVRRSYRALCK 184 >SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) Length = 1632 Score = 27.1 bits (57), Expect = 7.7 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +3 Query: 57 KRLSYSPYRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAM 236 K + YS K ++ AR S ++ + + + KR KKK++R N MKL+ + Sbjct: 893 KFVDYSEKAKLRASAQARNSRSPVEVAIEEEKRVAKRKKEQRKKKVRRRKNAAMKLANKL 952 Query: 237 CS 242 S Sbjct: 953 VS 954 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 287 ALDFYQTALRDPAFYQLYYRIVGYLNAFKHYLKPYPREKLHFVGV 421 AL + ALR P ++Y + L+ FK LK YP H + Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASI 224 >SB_20479| Best HMM Match : Collagen (HMM E-Value=1) Length = 1214 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +2 Query: 74 SLQKGKFESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQR 211 +LQ+G S K+++ A+ G+ Q++ ++ E E +DYQR Sbjct: 499 NLQRGYIASNQDKLEWKVFFAMGKTGDNSQDSRNIREAEEQRDYQR 544 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,916,034 Number of Sequences: 59808 Number of extensions: 288569 Number of successful extensions: 894 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 957531822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -