BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G09 (465 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40770.1 68415.m05030 SNF2 domain-containing protein / helica... 30 0.67 At5g22540.1 68418.m02630 expressed protein contains Pfam profile... 29 1.2 At2g45870.1 68415.m05705 expressed protein contains Pfam profile... 29 1.2 At3g52970.1 68416.m05839 cytochrome P450 family protein cytochro... 28 2.7 At5g15510.1 68418.m01816 expressed protein 27 4.7 At4g30825.1 68417.m04371 pentatricopeptide (PPR) repeat-containi... 27 4.7 At1g17460.1 68414.m02141 myb family transcription factor contain... 27 6.2 At4g10670.1 68417.m01743 transcription elongation factor-related... 27 8.3 At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domai... 27 8.3 At3g01015.1 68416.m00001 expressed protein ; expression supporte... 27 8.3 >At2g40770.1 68415.m05030 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger (C3HC4 type RING finger) family protein low similarity to SP|P36607 DNA repair protein rad8 {Schizosaccharomyces pombe}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1648 Score = 30.3 bits (65), Expect = 0.67 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 105 ARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQ 248 AR++I T+KR + P+ + +++N L+KL A C Q Sbjct: 719 AREVIETLKRDILKRGHTSSDNPLVTHAEAAKLLNSLLKLRQACCHPQ 766 >At5g22540.1 68418.m02630 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 440 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 29 EAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHDEKAINFV 148 EA LD+ KTFV + + + + K F+D + + FV Sbjct: 217 EAKHLLDLIRKTFVPVPSQRRIKDHSSKSSFNDHEYLGFV 256 >At2g45870.1 68415.m05705 expressed protein contains Pfam profile PF05249: Uncharacterised protein family (UPF0187) Length = 410 Score = 29.5 bits (63), Expect = 1.2 Identities = 24/77 (31%), Positives = 40/77 (51%) Frame = +3 Query: 84 KANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQHLNHS 263 K++ + ++ KLIS +K S+ I +R + K+ L N + S S++HL H Sbjct: 49 KSDDSPLSEKLISLLKAVPNWSDGIKERR-MQQKRSLYTHENWVRHRS----SLRHLRHV 103 Query: 264 TSTPSCPVRLTFTKPHF 314 +S+PS V L+ P F Sbjct: 104 SSSPSSRVILSLIPPVF 120 >At3g52970.1 68416.m05839 cytochrome P450 family protein cytochrome P450 76A2, eggplant, PIR:S38534 Length = 516 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +2 Query: 107 KKIDFHDEKAINFVGNYWQENADLYE----EEVTKDY 205 +K FH EKA G + +E ++ E +E TKDY Sbjct: 242 RKTQFHVEKAFEIAGEFIRERTEVREREKSDEKTKDY 278 >At5g15510.1 68418.m01816 expressed protein Length = 497 Score = 27.5 bits (58), Expect = 4.7 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 3/77 (3%) Frame = +2 Query: 110 KIDFHDEKAINFVGNYWQENA---DLYEEEVTKDYQRSYEIVARHVLGAAPKPFDKHTFM 280 + D+ + ++F+ Y E L EEE + ++ E+V + A P P+ F+ Sbjct: 397 EFDYQVAEKMSFIEQYKMERERQQKLAEEEEIRRLRK--ELVPK----AQPMPYFDRPFI 450 Query: 281 PSALDFYQTALRDPAFY 331 P + TA RDP F+ Sbjct: 451 PRRSSKHPTAPRDPKFH 467 >At4g30825.1 68417.m04371 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 904 Score = 27.5 bits (58), Expect = 4.7 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 350 QSCNIADRMQGLEVRFGKSQAHW 282 Q C++ D++Q L R KS HW Sbjct: 640 QKCDLQDKLQHLYYRIRKSGIHW 662 >At1g17460.1 68414.m02141 myb family transcription factor contains Pfam PF00249: Myb-like DNA-binding domain Length = 604 Score = 27.1 bits (57), Expect = 6.2 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +3 Query: 39 GSWTFLKRLSYSPY 80 G WT +K+LS+SPY Sbjct: 517 GKWTEIKKLSFSPY 530 >At4g10670.1 68417.m01743 transcription elongation factor-related low similarity to chromatin-specific transcription elongation factor FACT 140 kDa subunit [Homo sapiens] GI:5499741 Length = 470 Score = 26.6 bits (56), Expect = 8.3 Identities = 14/61 (22%), Positives = 33/61 (54%) Frame = +3 Query: 51 FLKRLSYSPYRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSL 230 +LK +S+ +S+ + +++ S ++ + +RT + ++KLQ + N+ LSL Sbjct: 61 YLKEVSFRTKDSRHSSDVVQQVKSLRRKVMARESERAERTSLVNQEKLQIVRNNSKPLSL 120 Query: 231 A 233 + Sbjct: 121 S 121 >At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domain-containing protein domain signature TIR exists, suggestive of a disease resistance protein. Length = 239 Score = 26.6 bits (56), Expect = 8.3 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 78 YRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIIND-LMKLSL 230 ++K NR ++ + + ++ T+G + IC + I ND L+KL+L Sbjct: 155 FKKTCQNRTEDEINLRRRALIDVANTLGYHSTICKANMTKEITNDVLVKLNL 206 >At3g01015.1 68416.m00001 expressed protein ; expression supported by MPSS Length = 488 Score = 26.6 bits (56), Expect = 8.3 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 3/76 (3%) Frame = +2 Query: 110 KIDFHDEKAINFVGNYWQENA---DLYEEEVTKDYQRSYEIVARHVLGAAPKPFDKHTFM 280 + D+ + IN V Y E L EEE + ++ E+V + A P P+ F+ Sbjct: 387 EFDYQVTEKINLVEQYKTERERQQKLAEEEEIRRLRK--ELVPK----AQPMPYFDRPFI 440 Query: 281 PSALDFYQTALRDPAF 328 P + + T RDP F Sbjct: 441 PKRSNKHPTVPRDPKF 456 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,583,142 Number of Sequences: 28952 Number of extensions: 196163 Number of successful extensions: 584 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 782033640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -