BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G07 (633 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycop... 30 5.9 BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycop... 30 5.9 BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycop... 30 5.9 BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycop... 30 5.9 AB007890-1|BAA24860.3| 1506|Homo sapiens KIAA0430 protein protein. 30 5.9 EF452236-1|ABO40479.1| 1866|Homo sapiens NOD4 protein. 30 7.8 AK090439-1|BAC03420.1| 1056|Homo sapiens FLJ00359 protein protein. 30 7.8 AK074182-1|BAB85008.1| 733|Homo sapiens FLJ00255 protein protein. 30 7.8 AK025362-1|BAB15120.1| 1097|Homo sapiens protein ( Homo sapiens ... 30 7.8 AF389420-1|AAO59377.1| 1866|Homo sapiens NOD27 protein. 30 7.8 >BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.3 bits (65), Expect = 5.9 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 57 VSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 218 V +T + VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 22 VKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.3 bits (65), Expect = 5.9 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 57 VSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 218 V +T + VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 22 VKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.3 bits (65), Expect = 5.9 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 57 VSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 218 V +T + VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 22 VKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.3 bits (65), Expect = 5.9 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 57 VSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 218 V +T + VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 22 VKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >AB007890-1|BAA24860.3| 1506|Homo sapiens KIAA0430 protein protein. Length = 1506 Score = 30.3 bits (65), Expect = 5.9 Identities = 14/62 (22%), Positives = 28/62 (45%) Frame = +3 Query: 288 YEFSIFYQKLREEAIALFHLFYYAKDFETFYKSAAFARVHLNEGQFLYAYYIAVIQRNDT 467 Y +F EE + L L+ +AK+ + + + ++ L+E Y Y+ + T Sbjct: 1232 YLVEVFTNDKMEECVKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKT 1291 Query: 468 HG 473 +G Sbjct: 1292 YG 1293 >EF452236-1|ABO40479.1| 1866|Homo sapiens NOD4 protein. Length = 1866 Score = 29.9 bits (64), Expect = 7.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 2 YEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 94 ++ CP HCP A + CG EN+S + ++C Sbjct: 669 FDGCPLEP--HCPEALVGCGQIENLSFKSRKC 698 >AK090439-1|BAC03420.1| 1056|Homo sapiens FLJ00359 protein protein. Length = 1056 Score = 29.9 bits (64), Expect = 7.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 2 YEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 94 ++ CP HCP A + CG EN+S + ++C Sbjct: 396 FDGCPLEP--HCPEALVGCGQIENLSFKSRKC 425 >AK074182-1|BAB85008.1| 733|Homo sapiens FLJ00255 protein protein. Length = 733 Score = 29.9 bits (64), Expect = 7.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 2 YEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 94 ++ CP HCP A + CG EN+S + ++C Sbjct: 682 FDGCPLEP--HCPEALVGCGQIENLSFKSRKC 711 >AK025362-1|BAB15120.1| 1097|Homo sapiens protein ( Homo sapiens cDNA: FLJ21709 fis, clone COL10077. ). Length = 1097 Score = 29.9 bits (64), Expect = 7.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 2 YEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 94 ++ CP HCP A + CG EN+S + ++C Sbjct: 354 FDGCPLEP--HCPEALVGCGQIENLSFKSRKC 383 >AF389420-1|AAO59377.1| 1866|Homo sapiens NOD27 protein. Length = 1866 Score = 29.9 bits (64), Expect = 7.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 2 YEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 94 ++ CP HCP A + CG EN+S + ++C Sbjct: 669 FDGCPLEP--HCPEALVGCGQIENLSFKSRKC 698 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,104,925 Number of Sequences: 237096 Number of extensions: 1772490 Number of successful extensions: 3323 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3323 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6916500330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -