Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0001_G04
         (555 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       21   6.3  
AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter...    21   6.3  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    21   6.3  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   6.3  
AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.          21   8.4  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 8/32 (25%), Positives = 17/32 (53%)
 Frame = +2

Query: 284 LTSVTSLIA*DDLIPLRRRSAQRRAATWPSSI 379
           L S+  ++  + ++PL  R     +AT+P  +
Sbjct: 365 LPSIEKMVDHETMVPLGERQTLMFSATFPDEV 396


>AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter
           transporter-1A protein.
          Length = 203

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 5/8 (62%), Positives = 8/8 (100%)
 Frame = +1

Query: 193 YPYICYRN 216
           +PY+CY+N
Sbjct: 7   FPYLCYKN 14


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 5/8 (62%), Positives = 8/8 (100%)
 Frame = +1

Query: 193 YPYICYRN 216
           +PY+CY+N
Sbjct: 45  FPYLCYKN 52


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 5/8 (62%), Positives = 8/8 (100%)
 Frame = +1

Query: 193 YPYICYRN 216
           +PY+CY+N
Sbjct: 98  FPYLCYKN 105


>AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.
          Length = 148

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 6/28 (21%)
 Frame = -2

Query: 251 VPHSVITRSFVWF------L*QMYGYGS 186
           + H+VI  SFVW       L  ++G+GS
Sbjct: 12  IRHAVILASFVWIYALSLSLPPLFGWGS 39


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 155,521
Number of Sequences: 438
Number of extensions: 3283
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15949830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)