BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G01 (591 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 28 0.93 01_01_0106 + 788967-789555,790139-790162,790339-791411 30 1.2 11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535,788... 27 8.5 03_05_0974 + 29324025-29324117,29325064-29325298,29325385-293257... 27 8.5 >03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 Length = 380 Score = 27.9 bits (59), Expect(2) = 0.93 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 417 NGISGNIGLNVDGNTERLVVESWLTNLEVVWVTS 316 NG + + G T+R+++ SWL+ LE+ + T+ Sbjct: 224 NGFTEAPETSNSGQTKRVLLSSWLSTLELAYTTA 257 Score = 21.4 bits (43), Expect(2) = 0.93 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 285 VSGIKLAIVKECD*FLNDNIIDFNADEMKFL 193 VSG ++A+ + L+ N++ + DEM L Sbjct: 298 VSGTRIALGDDGSIALSRNVVVLHVDEMLLL 328 >01_01_0106 + 788967-789555,790139-790162,790339-791411 Length = 561 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Frame = +1 Query: 349 PRLNHKPFSVTIDVKSDIATDA--VIKIFLGPKYNDYGFPITLEENWHKFYELDWFTHKI 522 P L + F V I KSD+ + V+++ G + D G +N H+ Y L+W K+ Sbjct: 437 PELYSRNFGV-ISYKSDVYSFGMLVLEMVSGRRNLDPGI-----DNQHEVYFLEWIYEKV 490 Query: 523 TPGQNKIV 546 GQN ++ Sbjct: 491 FTGQNLLI 498 >11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535, 7881648-7882304 Length = 451 Score = 27.5 bits (58), Expect = 8.5 Identities = 22/85 (25%), Positives = 36/85 (42%) Frame = +1 Query: 154 INAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQFDATNSVFLTKKEIKTSYPHN 333 +N F+ L PYP ++HF+ V+ + S + TNS F + P + Sbjct: 252 VNEFQTNLVPYP--RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRH 309 Query: 334 FKVRQPRLNHKPFSVTIDVKSDIAT 408 K L ++ V DV + +AT Sbjct: 310 GKYMACCLMYRGDVVPKDVNAAVAT 334 >03_05_0974 + 29324025-29324117,29325064-29325298,29325385-29325755, 29325864-29326520 Length = 451 Score = 27.5 bits (58), Expect = 8.5 Identities = 22/85 (25%), Positives = 36/85 (42%) Frame = +1 Query: 154 INAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQFDATNSVFLTKKEIKTSYPHN 333 +N F+ L PYP ++HF+ V+ + S + TNS F + P + Sbjct: 252 VNEFQTNLVPYP--RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRH 309 Query: 334 FKVRQPRLNHKPFSVTIDVKSDIAT 408 K L ++ V DV + +AT Sbjct: 310 GKYMACCLMYRGDVVPKDVNAAVAT 334 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,143,304 Number of Sequences: 37544 Number of extensions: 295048 Number of successful extensions: 710 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -