BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_G01 (591 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17480.1 68416.m02233 F-box family protein contains F-box dom... 32 0.25 At3g17490.1 68416.m02234 F-box family protein similar to F-box p... 30 1.0 At3g61160.2 68416.m06845 shaggy-related protein kinase beta / AS... 30 1.3 At3g61160.1 68416.m06844 shaggy-related protein kinase beta / AS... 30 1.3 At2g23200.1 68415.m02771 protein kinase family protein contains ... 29 2.3 At1g13260.1 68414.m01539 DNA-binding protein RAV1 (RAV1) identic... 28 5.4 At5g42800.1 68418.m05213 dihydroflavonol 4-reductase (dihydrokae... 27 7.1 At1g64290.1 68414.m07285 F-box protein-related contains TIGRFAM ... 27 7.1 At4g25940.1 68417.m03731 epsin N-terminal homology (ENTH) domain... 27 9.4 >At3g17480.1 68416.m02233 F-box family protein contains F-box domain Pfam:PF00646 Length = 373 Score = 32.3 bits (70), Expect = 0.25 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 466 TLEENWHKFYELDWFTHKITPGQNKIVRNSNEFSLFKED 582 T+ +W KF +D +TH+ G + N+ ++F ED Sbjct: 291 TIVTSWSKFLRVDLYTHRFYNGVTFFIDEENKAAVFSED 329 >At3g17490.1 68416.m02234 F-box family protein similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; contains Pfam PF00646: F-box domain and TIGRFAM TIGR01640: F-box protein interaction domain Length = 388 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -2 Query: 590 GKESSLKSENSFELRTILFCPGVILC 513 GK SSL N FE+ I C G+ILC Sbjct: 88 GKLSSLNDLNDFEISQIYPCDGLILC 113 >At3g61160.2 68416.m06845 shaggy-related protein kinase beta / ASK-beta (ASK2) identical to shaggy-related protein kinase beta SP:O23145 GI:2569931 from [Arabidopsis thaliana] Length = 438 Score = 29.9 bits (64), Expect = 1.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 430 LGPKYNDYGFPITLEENWHKFY 495 + P+YND+ FP + WHK + Sbjct: 337 MNPRYNDFKFPQIKAQPWHKIF 358 >At3g61160.1 68416.m06844 shaggy-related protein kinase beta / ASK-beta (ASK2) identical to shaggy-related protein kinase beta SP:O23145 GI:2569931 from [Arabidopsis thaliana] Length = 431 Score = 29.9 bits (64), Expect = 1.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 430 LGPKYNDYGFPITLEENWHKFY 495 + P+YND+ FP + WHK + Sbjct: 330 MNPRYNDFKFPQIKAQPWHKIF 351 >At2g23200.1 68415.m02771 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 834 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +1 Query: 394 SDIATDAVIKIFLGPKYNDYGFPITLEENWHKFYELDWFTHKITPGQNKIVRN---SNEF 564 S +A I++F P +D P ++N H Y L+ KITP + + R ++ Sbjct: 177 SSLALINAIEVFSAP--DDLEIPSASDKNLHTIYRLNVGGEKITPDNDTLGRTWLPDDDD 234 Query: 565 SLFKEDS 585 L+++DS Sbjct: 235 FLYRKDS 241 >At1g13260.1 68414.m01539 DNA-binding protein RAV1 (RAV1) identical to SP|Q9ZWM9 DNA-binding protein RAV1 {Arabidopsis thaliana}, RAV1 GI:3868857 from [Arabidopsis thaliana] Length = 344 Score = 27.9 bits (59), Expect = 5.4 Identities = 21/75 (28%), Positives = 35/75 (46%) Frame = +1 Query: 79 SALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFF 258 SA ++ A+ +L ++ +A KH+ P P + GV +N V V F Sbjct: 183 SAEALFEKAVTPSDVGKLNRLVIPKHHAEKHF--PLPSSNVSVKGVLLNFEDVNGKVWRF 240 Query: 259 DYSQFDATNSVFLTK 303 YS ++++ S LTK Sbjct: 241 RYSYWNSSQSYVLTK 255 >At5g42800.1 68418.m05213 dihydroflavonol 4-reductase (dihydrokaempferol 4-reductase) (DFR) nearly identical to GI:166686 Length = 382 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 403 ATDAVIKIFLGPKYNDYGFPITLEENWHKFYELDWFTHKIT 525 AT I FL PKY +Y P T E +++ + K+T Sbjct: 258 ATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLT 298 >At1g64290.1 68414.m07285 F-box protein-related contains TIGRFAM TIGR01640 : F-box protein interaction domain; Length = 364 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -1 Query: 357 ESWLTNLEVVWVTSLNLFFGQEYTVSG--IKLAIVKECD*FLNDNI-IDF 217 ESW NL ++ ++ +F Q Y V G ++ + V E N+ + IDF Sbjct: 39 ESWFVNLNLLRTNRISGYFIQHYIVKGHELRTSFVHERSDLQNNGVSIDF 88 >At4g25940.1 68417.m03731 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Chain B, Crystal Structure Of N-Terminal Domain Of Drosophila Ap180 (GP:13399617) [Drosophila melanogaster]; supporting cDNA gi|20465326|gb|AY096427.1| Length = 601 Score = 27.1 bits (57), Expect = 9.4 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 7/71 (9%) Frame = +1 Query: 115 PAFYQLYNRIVGYI---NAFKHYLKPYPQE---KLHF-VGVKINDVVVEKLVTFFDYSQF 273 PA QL R++G +A+ +YL Y K F + IND ++ + FF+ S+ Sbjct: 200 PALQQLLYRLIGCQPEGSAYSNYLIQYALALVLKESFKIYCAINDGIINLVDMFFEMSRH 259 Query: 274 DATNSVFLTKK 306 DA ++ + K+ Sbjct: 260 DAVKALNIYKR 270 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,567,876 Number of Sequences: 28952 Number of extensions: 251698 Number of successful extensions: 764 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 764 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -