BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F24 (541 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 2.6 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 4.6 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 8.1 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.6 bits (46), Expect = 2.6 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +3 Query: 324 LSIFT--VCSNLWQMSSNSPTIFYYKPHFQF*LYSLNYIVLKYVNTNFPFIY 473 +S+F V S L SS F Y+ F F LY +I + T F+Y Sbjct: 201 ISVFKAEVGSKLRPRSSFQGPPFTYRYGFSFLLYVSGFITTEVAGTYAIFLY 252 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = -1 Query: 361 ICHRFEQTVKIDKIFFLLNSKSKLQSHVIKSEWRYV 254 + E+T+ D F ++K+K + ++ +W+YV Sbjct: 508 LVREIEKTID-DARFIAQHAKNKDKFESVEEDWKYV 542 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 97 LDQCDADEDHRITLAEWGKC 156 LD D+D I +A++G C Sbjct: 113 LDNVLLDQDGHIKIADFGMC 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,687 Number of Sequences: 438 Number of extensions: 2554 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -