BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F24 (541 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08580.1 68418.m01021 calcium-binding EF hand family protein ... 33 0.092 At5g24280.1 68418.m02856 expressed protein ; expression supporte... 28 4.6 >At5g08580.1 68418.m01021 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 391 Score = 33.5 bits (73), Expect = 0.092 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Frame = +1 Query: 1 LDAHDNDRFVSRHELFPIRAPLMSLEHCIAP-----FLDQCDADEDHRITLAE 144 LD +D D ++S EL PI + + EH A + Q D+D+D R+TLAE Sbjct: 311 LDKND-DGYLSDVELLPIISKIHPTEHYYAKQQADYIISQADSDKDRRLTLAE 362 >At5g24280.1 68418.m02856 expressed protein ; expression supported by MPSS Length = 1634 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 64 LMSLEHCIAPFLDQCDADEDHRITLAEWGKCLQLDEYELEDRC 192 LM + ++ + DE+ R+ L E KCLQ E C Sbjct: 1287 LMDMAQYTEDLKEKINIDEERRVELEERLKCLQAQREHAEQEC 1329 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,032,436 Number of Sequences: 28952 Number of extensions: 174830 Number of successful extensions: 411 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1003808112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -