BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F22 (329 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9VP19 Cluster: CG7181-PA; n=5; Sophophora|Rep: CG7181-... 44 9e-04 UniRef50_Q692Y6 Cluster: Mitochondrial cytochrome c oxidase subu... 43 0.001 UniRef50_UPI0000F209A8 Cluster: PREDICTED: hypothetical protein;... 38 0.056 UniRef50_Q09JM4 Cluster: Cytochrome c oxidase polypeptide VIII; ... 38 0.056 UniRef50_UPI0000515C5B Cluster: PREDICTED: hypothetical protein;... 37 0.098 UniRef50_A4C5X1 Cluster: Putative uncharacterized protein; n=1; ... 34 0.52 UniRef50_Q4TC53 Cluster: Chromosome undetermined SCAF7053, whole... 33 1.2 UniRef50_A7RIA1 Cluster: Predicted protein; n=1; Nematostella ve... 32 2.8 UniRef50_UPI000038D26E Cluster: COG0642: Signal transduction his... 31 4.9 UniRef50_A3USP8 Cluster: Putative urea transporter; n=3; Vibrion... 31 6.5 UniRef50_Q5BYP8 Cluster: SJCHGC03300 protein; n=2; Schistosoma j... 31 6.5 UniRef50_UPI0000DB7BEC Cluster: PREDICTED: similar to CG31349-PB... 30 8.5 UniRef50_Q8RAZ3 Cluster: Chemotaxis response regulator protein-g... 30 8.5 >UniRef50_Q9VP19 Cluster: CG7181-PA; n=5; Sophophora|Rep: CG7181-PA - Drosophila melanogaster (Fruit fly) Length = 68 Score = 43.6 bits (98), Expect = 9e-04 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = +3 Query: 48 LKNVLQQRNMSVIATPARNKISKAEVVVLGSLMVVGWSAVPVWVLVNIKHYR 203 +++ +Q R SV++ P +IS AE V+LG M +P WVL +I+ Y+ Sbjct: 14 MRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAASLFIPAWVLYHIRDYK 65 >UniRef50_Q692Y6 Cluster: Mitochondrial cytochrome c oxidase subunit VIII-H; n=1; Branchiostoma belcheri tsingtauense|Rep: Mitochondrial cytochrome c oxidase subunit VIII-H - Branchiostoma belcheri tsingtauense Length = 71 Score = 42.7 bits (96), Expect = 0.001 Identities = 15/49 (30%), Positives = 30/49 (61%) Frame = +3 Query: 66 QRNMSVIATPARNKISKAEVVVLGSLMVVGWSAVPVWVLVNIKHYRDKE 212 Q+ +++ PA+N +S + + + ++ G +PVW+L N+K Y+ KE Sbjct: 23 QQRAGIMSEPAKNPMSSTDKAIGATAILAGVMGIPVWILCNLKRYQGKE 71 >UniRef50_UPI0000F209A8 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 138 Score = 37.5 bits (83), Expect = 0.056 Identities = 15/53 (28%), Positives = 31/53 (58%) Frame = +3 Query: 51 KNVLQQRNMSVIATPARNKISKAEVVVLGSLMVVGWSAVPVWVLVNIKHYRDK 209 ++++ +RN S+ + P +NKI + ++ S+ V A W+L +I YR++ Sbjct: 80 RDIVHKRNSSIYSKPPKNKIGPGQSFLIMSVFAVALLAPAGWILHHIPEYRER 132 >UniRef50_Q09JM4 Cluster: Cytochrome c oxidase polypeptide VIII; n=2; Ixodoidea|Rep: Cytochrome c oxidase polypeptide VIII - Argas monolakensis Length = 69 Score = 37.5 bits (83), Expect = 0.056 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 15 VQSLLRTNRQILKNVLQQ---RNMS-VIATPARNKISKAEVVVLGSLMVVGWSAVPVWVL 182 + S+++ + +++N Q R+M +I TP R +IS AE V + G A+P WVL Sbjct: 1 MNSIVQRSCTVIRNTKMQVRYRSMCRMIVTPPRVRISTAEKVGHLVALTAGILAIPAWVL 60 Query: 183 VNIKHYRDK 209 V++ Y+ K Sbjct: 61 VHLGDYKKK 69 >UniRef50_UPI0000515C5B Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 70 Score = 36.7 bits (81), Expect = 0.098 Identities = 19/65 (29%), Positives = 32/65 (49%) Frame = +3 Query: 6 MLGVQSLLRTNRQILKNVLQQRNMSVIATPARNKISKAEVVVLGSLMVVGWSAVPVWVLV 185 M VQ + L Q S + TP R ++S E ++ G + VG A+P+++ Sbjct: 1 MFAVQKIANGAPLALNLYKTQCRTSFLGTPPRVRVSFTEKMLHGVALYVGLMAIPLYIAC 60 Query: 186 NIKHY 200 N+K+Y Sbjct: 61 NVKNY 65 >UniRef50_A4C5X1 Cluster: Putative uncharacterized protein; n=1; Pseudoalteromonas tunicata D2|Rep: Putative uncharacterized protein - Pseudoalteromonas tunicata D2 Length = 1053 Score = 34.3 bits (75), Expect = 0.52 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = -2 Query: 211 SLSL*CLMLTRTHTGTA-DQPTTIKLPNTTTSAFEILFLAGVAI 83 SLSL L ++RTH GT + + + LP + +F + FLAG+++ Sbjct: 515 SLSLVLLAISRTHRGTGLGKLSIMNLPKSVMMSFSVTFLAGLSL 558 >UniRef50_Q4TC53 Cluster: Chromosome undetermined SCAF7053, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF7053, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 176 Score = 33.1 bits (72), Expect = 1.2 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +3 Query: 51 KNVLQQRNMSVIATPARNKISKAEVVVLGSLMVVGWSAVPVWVLVNIKHYRDK 209 K V+++ + + P RNKI A+ + S+ V A W+L ++ YR + Sbjct: 117 KQVVKELRRKIYSKPPRNKIGAAQSFFVMSVFTVVMLAPAAWILHHLPEYRQR 169 >UniRef50_A7RIA1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 290 Score = 31.9 bits (69), Expect = 2.8 Identities = 21/60 (35%), Positives = 31/60 (51%) Frame = -2 Query: 181 RTHTGTADQPTTIKLPNTTTSAFEILFLAGVAITLMFLCWSTFFRICRLVLRRLWTPNIL 2 R+ T T D+ T K T +AGV + F+CW FF LVL+ LW+P+++ Sbjct: 203 RSSTLTRDRIATFKREIKATK-----MMAGV-VGAFFICWFPFFV---LVLKSLWSPSVI 253 >UniRef50_UPI000038D26E Cluster: COG0642: Signal transduction histidine kinase; n=1; Nostoc punctiforme PCC 73102|Rep: COG0642: Signal transduction histidine kinase - Nostoc punctiforme PCC 73102 Length = 835 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -2 Query: 130 TTTSAFEILFLAGVAITLMFLCWSTFFRICRLVLRR 23 +TTS + FL G+ + L + W T++ IC+ ++R Sbjct: 182 STTSQAMVTFLVGIGLNLAIILW-TYYLICKETMKR 216 >UniRef50_A3USP8 Cluster: Putative urea transporter; n=3; Vibrionales|Rep: Putative urea transporter - Vibrio splendidus 12B01 Length = 322 Score = 30.7 bits (66), Expect = 6.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 220 CFYSLSL*CLMLTRTHTGTADQPTTIKLPNTTTSAFEI 107 C Y+L+ C M T T+T T T NT +A++I Sbjct: 53 CSYALAFCCYMYTNTNTNTNTNTNTNTNTNTNKAAYDI 90 >UniRef50_Q5BYP8 Cluster: SJCHGC03300 protein; n=2; Schistosoma japonicum|Rep: SJCHGC03300 protein - Schistosoma japonicum (Blood fluke) Length = 249 Score = 30.7 bits (66), Expect = 6.5 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 91 HPLEIRFQKQKWLCWAV*WW-WAGLLSQCGFSSTSNT 198 H + K + L W+ WW W G LS CGF + +T Sbjct: 80 HSQAFGYIKSRILWWS--WWVWLGFLSSCGFGTGLHT 114 >UniRef50_UPI0000DB7BEC Cluster: PREDICTED: similar to CG31349-PB, isoform B; n=1; Apis mellifera|Rep: PREDICTED: similar to CG31349-PB, isoform B - Apis mellifera Length = 1131 Score = 30.3 bits (65), Expect = 8.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 32 NQPTDPKECAPTEKHERYRYTR 97 N P D K APT H+ YR+TR Sbjct: 930 NVPDDLKSSAPTRPHDPYRFTR 951 >UniRef50_Q8RAZ3 Cluster: Chemotaxis response regulator protein-glutamate methylesterase; n=2; Clostridia|Rep: Chemotaxis response regulator protein-glutamate methylesterase - Thermoanaerobacter tengcongensis Length = 367 Score = 30.3 bits (65), Expect = 8.5 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +3 Query: 9 LGVQSLLRTNRQILKNVLQQRNMSVIATPARNKISKAEVVVL 134 L + LL ++R K +L++RN V NKISK E+VV+ Sbjct: 133 LSNKELLSSSRNF-KKLLKRRNQEVTRKVYENKISKKEIVVV 173 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 319,201,880 Number of Sequences: 1657284 Number of extensions: 5783980 Number of successful extensions: 20622 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 19108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20582 length of database: 575,637,011 effective HSP length: 86 effective length of database: 433,110,587 effective search space used: 9961543501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -