Samia BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0001_F21
         (205 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_1116 + 9197761-9199956                                           26   4.8  

>06_01_1116 + 9197761-9199956
          Length = 731

 Score = 25.8 bits (54), Expect = 4.8
 Identities = 9/31 (29%), Positives = 18/31 (58%)
 Frame = -1

Query: 175 WFNSLLCNLETALNSCFSL*HCFSLPIYFML 83
           WF  + C+ +  LN+C+ + H   + + F+L
Sbjct: 399 WFPGVKCSFKLRLNTCWVICHLEPVSMIFVL 429


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,936,984
Number of Sequences: 37544
Number of extensions: 31424
Number of successful extensions: 52
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52
length of database: 14,793,348
effective HSP length: 47
effective length of database: 13,028,780
effective search space used: 260575600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)