BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F21 (205 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37776| Best HMM Match : fn3 (HMM E-Value=1.4e-22) 26 4.1 SB_27431| Best HMM Match : HEAT (HMM E-Value=2.4) 25 9.5 >SB_37776| Best HMM Match : fn3 (HMM E-Value=1.4e-22) Length = 1296 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +3 Query: 102 KEKQCYKEKQLFRAVSRLQSNELNHLIKLNYNL 200 K+K+C K + ++A R++ +LN ++ N N+ Sbjct: 1159 KDKRCSKLMEEYKANRRVEDEKLNATLRHNVNI 1191 >SB_27431| Best HMM Match : HEAT (HMM E-Value=2.4) Length = 195 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 105 EKQCYKEKQLFRAVSRLQSNELNHL 179 +K+C KQL R + R+ S+ LNH+ Sbjct: 133 DKRC---KQLLRIIKRMVSSNLNHV 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,676,332 Number of Sequences: 59808 Number of extensions: 42514 Number of successful extensions: 171 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 16,821,457 effective HSP length: 46 effective length of database: 14,070,289 effective search space used: 295476069 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -