BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F21 (205 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26710.1 68418.m03168 glutamate-tRNA ligase, putative / gluta... 25 9.1 At5g22600.1 68418.m02640 expressed protein ; expression supporte... 25 9.1 >At5g26710.1 68418.m03168 glutamate-tRNA ligase, putative / glutamyl-tRNA synthetase, putatuve / GluRS, putative identical to gi:3435196 Length = 719 Score = 24.6 bits (51), Expect = 9.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 187 SLIKWFNSLLCNLETALN 134 SL++WFNS+L LN Sbjct: 148 SLVRWFNSILDEYSEVLN 165 >At5g22600.1 68418.m02640 expressed protein ; expression supported by MPSS Length = 418 Score = 24.6 bits (51), Expect = 9.1 Identities = 7/32 (21%), Positives = 20/32 (62%) Frame = -2 Query: 204 NISYSSV*LSGSIHYFVIWKLP*IAVFLCNTV 109 N+ + V L G +++ W++ +++++C T+ Sbjct: 65 NLQHLDVELGGCVYFREYWEVMPVSLYICETL 96 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,689,119 Number of Sequences: 28952 Number of extensions: 31858 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 12,070,560 effective HSP length: 47 effective length of database: 10,709,816 effective search space used: 214196320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -