BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F19 (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.7 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 22 3.7 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.7 EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hor... 21 6.5 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -3 Query: 635 SGLFRRVESFEYMLVPERDRFVPSRQRVTV 546 S + R E+F+ ++VPE D ++R+ + Sbjct: 254 SVIAERQENFKEIVVPETDEVYTGKRRLAM 283 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 22.2 bits (45), Expect = 3.7 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 268 DDCF-KHFPKQKNSSR*SANCLTKNTY 345 D C+ +HF K KN S NCL N Y Sbjct: 36 DPCYGRHFFK-KNLIVGSENCLVLNVY 61 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -3 Query: 635 SGLFRRVESFEYMLVPERDRFVPSRQRVTV 546 S + R E+F+ ++VPE D ++R+ + Sbjct: 254 SVIAERQENFKEIVVPETDEVYTGKRRLAM 283 >EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hormone 1 protein. Length = 73 Score = 21.4 bits (43), Expect = 6.5 Identities = 6/13 (46%), Positives = 12/13 (92%) Frame = -3 Query: 509 LFQITEMSFFNLP 471 +++I ++SFFN+P Sbjct: 52 IYKIIQVSFFNIP 64 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,409 Number of Sequences: 336 Number of extensions: 3434 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -