BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F10 (376 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 42 2e-04 SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 5e-04 SB_55143| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 36 0.008 SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.033 SB_54268| Best HMM Match : Vicilin_N (HMM E-Value=0.077) 30 0.70 SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) 28 2.1 SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.1 SB_52654| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 27 5.0 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 27 6.5 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 27 6.5 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 27 6.5 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 26 8.7 SB_32905| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.7 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 26 8.7 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 26 8.7 >SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 829 Score = 41.5 bits (93), Expect = 2e-04 Identities = 25/74 (33%), Positives = 36/74 (48%) Frame = +3 Query: 129 CYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHAN 308 CYY + S R P D++P L CTH+L+ A + T+K+ EN H Sbjct: 25 CYYTNWSQYRPKGGTFWPEDIDPFL--CTHILFSFAKVNQTTHKLDIYEEN-----DHEL 77 Query: 309 YRAITNLKRQFPQL 350 Y+ I LK+ P+L Sbjct: 78 YQRINALKKINPKL 91 Score = 37.1 bits (82), Expect = 0.005 Identities = 23/75 (30%), Positives = 37/75 (49%) Frame = +3 Query: 126 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHA 305 +CYY + S R P D++P L CTH+++ + + T+ M +N D D Sbjct: 409 VCYYTNWSQYRPKGGTFWPEDIDPHL--CTHVIHSFSKVNLTTHVMEKYEKN-DFDL--- 462 Query: 306 NYRAITNLKRQFPQL 350 Y+ I LK+ P+L Sbjct: 463 -YKRINALKKINPKL 476 >SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 807 Score = 40.3 bits (90), Expect = 5e-04 Identities = 25/79 (31%), Positives = 40/79 (50%) Frame = +3 Query: 126 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHA 305 +CY+ + + R + LP D++P L CTH++Y A I T K+ + N D Sbjct: 401 VCYFTNWAQYRPDPVKFLPKDIDPLL--CTHIVYAFAKIDPATNKIGTYEWNDD-----R 453 Query: 306 NYRAITNLKRQFPQLARVL 362 Y+ I +LK + P L +L Sbjct: 454 LYKEINDLKLKNPSLKTLL 472 >SB_55143| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 270 Score = 36.3 bits (80), Expect = 0.008 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 1/80 (1%) Frame = +3 Query: 126 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGI-QADTYKMVSLNENLDIDRAH 302 +CY+ + S R+ +A+ P D+ PA CTHL+Y A I Q + M N+ D+ + Sbjct: 22 VCYHTNWSQYRQGRAKFWPEDI-PA-DLCTHLMYSFAKINQKNELAMYEWND----DKLY 75 Query: 303 ANYRAITNLKRQFPQLARVL 362 + A LK++ P+L +L Sbjct: 76 PRFNA---LKQKNPELKTLL 92 >SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 34.3 bits (75), Expect = 0.033 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +3 Query: 126 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNEN 281 +CYY + + R A+ P +++P+L CTH++Y A + AD K+ N Sbjct: 25 VCYYTNWAQYR-GLAKYTPDNIDPSL--CTHIVYAFAKMNADNSKLAMFEWN 73 >SB_54268| Best HMM Match : Vicilin_N (HMM E-Value=0.077) Length = 371 Score = 29.9 bits (64), Expect = 0.70 Identities = 22/77 (28%), Positives = 36/77 (46%) Frame = +3 Query: 138 DSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHANYRA 317 + + IRE A + L LS C+H L+ G+Q + +S ++++ D R Sbjct: 113 EMEDVIREKNA--VEMQLNQQLSQCSHKLFSVIGVQ-ELQDRISTSDSVSDDLQDVFGRQ 169 Query: 318 ITNLKRQFPQLARVLDQ 368 I L+ Q L R L+Q Sbjct: 170 IIALQTQRDDLMRQLEQ 186 >SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) Length = 769 Score = 28.3 bits (60), Expect = 2.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 52 PSPGYWR*RLRLPTTQHHLVAKAKSSATMTARAISENLKHVCCLRTW 192 P P R R PT H K + T T R ++ +KHV +RT+ Sbjct: 316 PEPTDKRRRDEPPTDIHERRRYRKVTKTKTIRTVTTTVKHVVTVRTY 362 >SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1670 Score = 28.3 bits (60), Expect = 2.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 52 PSPGYWR*RLRLPTTQHHLVAKAKSSATMTARAISENLKHVCCLRTW 192 P P R R PT H K + T T R ++ +KHV +RT+ Sbjct: 983 PEPTDKRRRDEPPTDIHERRRYRKVTKTKTIRTVTTTVKHVVTVRTY 1029 >SB_52654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.1 bits (57), Expect = 5.0 Identities = 9/33 (27%), Positives = 21/33 (63%) Frame = +1 Query: 106 LVAKAKSSATMTARAISENLKHVCCLRTWSLLF 204 LVA+ K++ TAR + + +H+ + W++++ Sbjct: 65 LVARCKNALIQTARTVVKRHRHMIAQQRWTVVY 97 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 27.1 bits (57), Expect = 5.0 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -1 Query: 271 SETILYVSAWMPADLYSRWVQNERAGSKSVGSI 173 + T++ +AW D Y W+Q + G+ V S+ Sbjct: 398 ASTVIIDTAWCAGDSYDCWLQVDLGGTHCVTSV 430 >SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) Length = 362 Score = 26.6 bits (56), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 238 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 348 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 230 ANNLYSVDYYVKKVVWDLMGEVLHYKHQQGTKDSWLN 266 >SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) Length = 279 Score = 26.6 bits (56), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 238 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 348 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 147 ANNLYSVDYYVKKVVWDLMGEVLHYKHQQGTKDSWLN 183 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 26.6 bits (56), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 238 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 348 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 400 ANNLYSVDYYVKKVVWDLMGEVLHYKHQQGTKDSWLN 436 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 26.2 bits (55), Expect = 8.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 238 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 348 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 230 ANNLHGVDYYVKKVVWDLMGEVLEYKHQQGTKDSWLN 266 >SB_32905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 26.2 bits (55), Expect = 8.7 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 106 LVAKAKSSATMTARAISENLKHVCCLRTWSLLFRSAPICCTNLP 237 L+ KA ++T T S+ V CLR + L R+ P C N+P Sbjct: 110 LMGKAGRASTPTCARRSD----VHCLREYVHLMRTNPDLCVNIP 149 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 26.2 bits (55), Expect = 8.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 238 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 348 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 229 ANNLYGVDYYVKKVVWDLMGEVLEYKHQQGTKDSWLN 265 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 26.2 bits (55), Expect = 8.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 238 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 348 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 146 ANNLYGVDYYVKKVVWDLMGEVLEYKHQQGTKDSWLN 182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,908,356 Number of Sequences: 59808 Number of extensions: 198953 Number of successful extensions: 552 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 619783250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -