BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F06 (589 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyc... 29 0.50 SPBC530.15c ||SPBC661.01|spermidine family transporter |Schizosa... 28 1.2 SPAC11E3.11c |||guanyl-nucleotide exchange factor |Schizosacchar... 27 2.7 SPCPB1C11.02 |||amino acid permease, unknown 16|Schizosaccharomy... 26 4.7 SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|c... 25 8.2 SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog 1|Schizosa... 25 8.2 >SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 781 Score = 29.1 bits (62), Expect = 0.50 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 473 HVPGNRMPCNGDTKTPKCQKNCESSYNVPFKKEQRYGKH 589 HVPGN P K+P QK+ + +P + + H Sbjct: 80 HVPGNNSPLQTPQKSPPRQKHTAPATPIPVSASRHHKPH 118 >SPBC530.15c ||SPBC661.01|spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 516 Score = 27.9 bits (59), Expect = 1.2 Identities = 14/55 (25%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +2 Query: 89 DDNILKLPKVTHDAELIANL--PENFDPRDKWPECPTLNEIRDQGSCGSCWAFGA 247 ++++ K P +++ + I L P++ D WP L + GS C FG+ Sbjct: 37 EESLKKYPVISNPQDFIVTLDGPDDPDLAVNWPLAKKLRNVAVMGSACLCAGFGS 91 >SPAC11E3.11c |||guanyl-nucleotide exchange factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 942 Score = 26.6 bits (56), Expect = 2.7 Identities = 20/57 (35%), Positives = 26/57 (45%) Frame = -2 Query: 276 MHTRSVIASTAPKAQQLPHDP*SLISFNVGHSGHLSLGSKFSGRFAISSAS*VTLGN 106 M + S I S+ P QLP P + +SF + LG FS +SS S T N Sbjct: 137 MTSMSSITSSTPTPSQLPVRPSTSLSF----FDDIPLGPSFSAETILSSLSISTSNN 189 >SPCPB1C11.02 |||amino acid permease, unknown 16|Schizosaccharomyces pombe|chr 3|||Manual Length = 505 Score = 25.8 bits (54), Expect = 4.7 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 338 ICGLGCNGGMPTLAWEYWKHVGLVSGG 418 +C LG N + + YWK G + G Sbjct: 194 LCNLGVNNEKKFIGFRYWKDPGAFNNG 220 >SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 25.0 bits (52), Expect = 8.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 417 PPDTSPTCFQYSQAKVGIPPLQPR 346 PP PT YSQ ++G P L+P+ Sbjct: 438 PPVPHPTSL-YSQIRIGCPYLKPK 460 >SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 941 Score = 25.0 bits (52), Expect = 8.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 476 RDVHTVEFRKVGNLGLSYNCHPIQAQRASNIPK 378 RD HT F G++Y H ++ + IPK Sbjct: 886 RDDHTFSFDYKLKKGVNYQSHGLKVAEMAGIPK 918 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,493,226 Number of Sequences: 5004 Number of extensions: 51193 Number of successful extensions: 156 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 254167452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -