BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F06 (589 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02305.1 68414.m00175 cathepsin B-like cysteine protease, put... 133 1e-31 At4g01610.1 68417.m00210 cathepsin B-like cysteine protease, put... 125 3e-29 At4g01610.2 68417.m00211 cathepsin B-like cysteine protease, put... 119 1e-27 At1g02300.1 68414.m00173 cathepsin B-like cysteine protease, put... 105 2e-23 At4g39090.1 68417.m05535 cysteine proteinase RD19a (RD19A) / thi... 61 6e-10 At2g21430.1 68415.m02550 cysteine proteinase A494, putative / th... 60 1e-09 At5g60360.1 68418.m07568 cysteine proteinase, putative / AALP pr... 59 2e-09 At4g36880.1 68417.m05229 cysteine proteinase, putative strong si... 57 1e-08 At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol pro... 56 2e-08 At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol p... 56 2e-08 At3g45310.1 68416.m04892 cysteine proteinase, putative similar t... 56 2e-08 At1g20850.1 68414.m02612 cysteine endopeptidase, papain-type (XC... 55 3e-08 At4g35350.2 68417.m05022 cysteine endopeptidase, papain-type (XC... 55 4e-08 At4g35350.1 68417.m05023 cysteine endopeptidase, papain-type (XC... 55 4e-08 At5g50260.1 68418.m06224 cysteine proteinase, putative similar t... 54 9e-08 At3g54940.3 68416.m06091 cysteine proteinase, putative contains ... 53 1e-07 At4g16190.1 68417.m02457 cysteine proteinase, putative contains ... 53 2e-07 At5g45890.1 68418.m05644 senescence-specific SAG12 protein (SAG1... 52 2e-07 At1g09850.1 68414.m01109 cysteine protease, papain-like (XBCP3) ... 52 2e-07 At3g48350.1 68416.m05277 cysteine proteinase, putative similar t... 52 3e-07 At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol p... 51 5e-07 At2g27420.1 68415.m03314 cysteine proteinase, putative contains ... 51 7e-07 At3g19400.2 68416.m02460 cysteine proteinase, putative non-conse... 48 5e-06 At3g19400.1 68416.m02461 cysteine proteinase, putative non-conse... 48 5e-06 At4g11310.1 68417.m01827 cysteine proteinase, putative contains ... 46 2e-05 At1g29090.1 68414.m03561 peptidase C1A papain family protein con... 46 2e-05 At1g06260.1 68414.m00662 cysteine proteinase, putative contains ... 45 3e-05 At4g23520.1 68417.m03390 cysteine proteinase, putative contains ... 45 4e-05 At1g29080.1 68414.m03560 peptidase C1A papain family protein con... 45 4e-05 At2g34080.1 68415.m04172 cysteine proteinase, putative contains ... 44 6e-05 At3g54940.2 68416.m06090 cysteine proteinase, putative contains ... 44 8e-05 At4g11320.1 68417.m01828 cysteine proteinase, putative contains ... 44 1e-04 At3g49340.1 68416.m05394 cysteine proteinase, putative contains ... 42 2e-04 At3g43960.1 68416.m04706 cysteine proteinase, putative contains ... 42 4e-04 At3g48340.1 68416.m05276 cysteine proteinase, putative similar t... 37 0.009 At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c... 29 3.0 At5g54320.1 68418.m06765 hypothetical protein contains Pfam prof... 28 5.3 At4g31260.1 68417.m04437 hypothetical protein 27 7.0 At5g55890.1 68418.m06967 hypothetical protein contains Pfam prof... 27 9.3 At5g55880.1 68418.m06966 hypothetical protein contains Pfam prof... 27 9.3 At5g54470.1 68418.m06783 zinc finger (B-box type) family protein... 27 9.3 At1g61460.1 68414.m06925 S-locus protein kinase, putative contai... 27 9.3 >At1g02305.1 68414.m00175 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase [Nicotiana rustica] GI:609175; contains Pfam profile PF00112: Papain family cysteine protease Length = 362 Score = 133 bits (321), Expect = 1e-31 Identities = 78/194 (40%), Positives = 103/194 (53%), Gaps = 5/194 (2%) Frame = +2 Query: 17 WKAGRNFP-THTPFAHIKILMGA--LKDDNILKLPKVTHDAELIANLPENFDPRDKWPEC 187 WKA N + A K L+G L +P V+HD L LP+ FD R W +C Sbjct: 62 WKASFNDRFANATVAEFKRLLGVKPTPKTEFLGVPIVSHDISL--KLPKEFDARTAWSQC 119 Query: 188 PTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCP-ICGLGCNGG 364 ++ I DQG CGSCWAFGAVE+++DR CI N + S DL++CC +CG GCNGG Sbjct: 120 TSIGRILDQGHCGSCWAFGAVESLSDRFCIKYN--MNVSLSVNDLLACCGFLCGQGCNGG 177 Query: 365 MPTLAWEYWKHVGLVSGGNYNSSQGCRPY-EIPPCEHHVPGNRMPCNGDTKTPKCQKNCE 541 P AW Y+KH G+V ++ C PY + C H PG C TPKC + C Sbjct: 178 YPIAAWRYFKHHGVV-------TEECDPYFDNTGCSH--PG----CEPAYPTPKCARKCV 224 Query: 542 SSYNVPFKKEQRYG 583 S N +++ + YG Sbjct: 225 SG-NQLWRESKHYG 237 >At4g01610.1 68417.m00210 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase GI:609175 from [Nicotiana rustica]; contains an unusually short, 5nt exon Length = 359 Score = 125 bits (301), Expect = 3e-29 Identities = 72/181 (39%), Positives = 97/181 (53%), Gaps = 5/181 (2%) Frame = +2 Query: 17 WKAGRNFP-THTPFAHIKILMGA--LKDDNILKLPKVTHDAELIANLPENFDPRDKWPEC 187 WKA N ++ A K L+G + L +P V+HD L LP+ FD R WP+C Sbjct: 59 WKAAINDRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSL--KLPKAFDARTAWPQC 116 Query: 188 PTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPI-CGLGCNGG 364 ++ I DQG CGSCWAFGAVE+++DR CI + S DL++CC CG GC+GG Sbjct: 117 TSIGNILDQGHCGSCWAFGAVESLSDRFCIQFG--MNISLSVNDLLACCGFRCGDGCDGG 174 Query: 365 MPTLAWEYWKHVGLVSGGNYNSSQGCRPY-EIPPCEHHVPGNRMPCNGDTKTPKCQKNCE 541 P AW+Y+ + G+V ++ C PY + C H PG C TPKC + C Sbjct: 175 YPIAAWQYFSYSGVV-------TEECDPYFDNTGCSH--PG----CEPAYPTPKCSRKCV 221 Query: 542 S 544 S Sbjct: 222 S 222 >At4g01610.2 68417.m00211 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase GI:609175 from [Nicotiana rustica]; contains an unusually short, 5nt exon Length = 359 Score = 119 bits (287), Expect = 1e-27 Identities = 70/181 (38%), Positives = 95/181 (52%), Gaps = 5/181 (2%) Frame = +2 Query: 17 WKAGRNFP-THTPFAHIKILMGA--LKDDNILKLPKVTHDAELIANLPENFDPRDKWPEC 187 WKA N ++ A K L+G + L +P V+HD L LP+ FD R WP+C Sbjct: 59 WKAAINDRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSL--KLPKAFDARTAWPQC 116 Query: 188 PTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPI-CGLGCNGG 364 ++ I G CGSCWAFGAVE+++DR CI + S DL++CC CG GC+GG Sbjct: 117 TSIGNILGLGHCGSCWAFGAVESLSDRFCIQFG--MNISLSVNDLLACCGFRCGDGCDGG 174 Query: 365 MPTLAWEYWKHVGLVSGGNYNSSQGCRPY-EIPPCEHHVPGNRMPCNGDTKTPKCQKNCE 541 P AW+Y+ + G+V ++ C PY + C H PG C TPKC + C Sbjct: 175 YPIAAWQYFSYSGVV-------TEECDPYFDNTGCSH--PG----CEPAYPTPKCSRKCV 221 Query: 542 S 544 S Sbjct: 222 S 222 >At1g02300.1 68414.m00173 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase GI:609175 from [Nicotiana rustica] Length = 379 Score = 105 bits (252), Expect = 2e-23 Identities = 76/214 (35%), Positives = 102/214 (47%), Gaps = 25/214 (11%) Frame = +2 Query: 17 WKAGRNFP-THTPFAHIKILMGALKDDNI--LKLPKVTHDAELIANLPENFDPRDKWPEC 187 WKA N + A K L+G ++ L +P V HD L LP+ FD R W C Sbjct: 59 WKAAFNDRFANATVAEFKRLLGVIQTPKTAYLGVPIVRHDLSL--KLPKEFDARTAWSHC 116 Query: 188 PTLNEIRDQ--------------------GSCGSCWAFGAVEAMTDRVCIYSNATKHFHF 307 ++ I G CGSCWAFGAVE+++DR CI N + Sbjct: 117 TSIRRILVGYILNNVLLWSTITLWFWFLLGHCGSCWAFGAVESLSDRFCIKYNL--NVSL 174 Query: 308 SAEDLVSCCP-ICGLGCNGGMPTLAWEYWKHVGLVSGGNYNSSQGCRPY-EIPPCEHHVP 481 SA D+++CC +CG GCNGG P AW Y+K+ G+V +Q C PY + C H P Sbjct: 175 SANDVIACCGLLCGFGCNGGFPMGAWLYFKYHGVV-------TQECDPYFDNTGCSH--P 225 Query: 482 GNRMPCNGDTKTPKCQKNCESSYNVPFKKEQRYG 583 G C TPKC++ C S N + + + YG Sbjct: 226 G----CEPTYPTPKCERKCVSR-NQLWGESKHYG 254 >At4g39090.1 68417.m05535 cysteine proteinase RD19a (RD19A) / thiol protease identical to cysteine proteinase RD19a, thiol protease SP:P43296, GI:435618 from [Arabidopsis thaliana] Length = 368 Score = 60.9 bits (141), Expect = 6e-10 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 11/118 (9%) Frame = +2 Query: 104 KLPKVTHDAELIA--NLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCI 277 KLPK + A ++ NLPE+FD RD P +++QGSCGSCW+F A A+ + Sbjct: 119 KLPKDANKAPILPTENLPEDFDWRDHGAVTP----VKNQGSCGSCWSFSATGALEGANFL 174 Query: 278 YSNATKHFHFSAEDLVSC--------CPICGLGCNGGMPTLAWEY-WKHVGLVSGGNY 424 + K S + LV C C GCNGG+ A+EY K GL+ +Y Sbjct: 175 ATG--KLVSLSEQQLVDCDHECDPEEADSCDSGCNGGLMNSAFEYTLKTGGLMKEEDY 230 >At2g21430.1 68415.m02550 cysteine proteinase A494, putative / thiol protease, putative identical to SP:P43295 Probable cysteine proteinase A494 precursor [Arabidopsis thaliana]; strong similarity to cysteine proteinase RD19A (thiol protease) GI:435618, SP:P43296 from [Arabidopsis thaliana] Length = 361 Score = 60.1 bits (139), Expect = 1e-09 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 10/110 (9%) Frame = +2 Query: 104 KLPKVTHDAELIA--NLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCI 277 KLPK + A ++ NLPE FD RD+ P +++QGSCGSCW+F A+ + Sbjct: 116 KLPKDANQAPILPTQNLPEEFDWRDRGAVTP----VKNQGSCGSCWSFSTTGALEGAHFL 171 Query: 278 YSNATKHFHFSAEDLVSC---CP-----ICGLGCNGGMPTLAWEYWKHVG 403 + K S + LV C C C GCNGG+ A+EY G Sbjct: 172 ATG--KLVSLSEQQLVDCDHECDPEEEGSCDSGCNGGLMNSAFEYTLKTG 219 >At5g60360.1 68418.m07568 cysteine proteinase, putative / AALP protein (AALP) identical to AALP protein GI:7230640 from [Arabidopsis thaliana]; similar to barley aleurain Length = 358 Score = 58.8 bits (136), Expect = 2e-09 Identities = 33/89 (37%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = +2 Query: 140 ANLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAED 319 A LPE D W E ++ ++DQG CGSCW F A+ + K S + Sbjct: 139 AALPETKD----WREDGIVSPVKDQGGCGSCWTFSTTGAL--EAAYHQAFGKGISLSEQQ 192 Query: 320 LVSCC-PICGLGCNGGMPTLAWEYWKHVG 403 LV C GCNGG+P+ A+EY K G Sbjct: 193 LVDCAGAFNNYGCNGGLPSQAFEYIKSNG 221 >At4g36880.1 68417.m05229 cysteine proteinase, putative strong similarity to cysteine proteinase COT44 precursor SP:P25251 from [Brassica napus] (Rape) Length = 376 Score = 56.8 bits (131), Expect = 1e-08 Identities = 44/144 (30%), Positives = 66/144 (45%), Gaps = 4/144 (2%) Frame = +2 Query: 5 KQNTWKAG-RNFPTHTPFAHIKILMGALKDD--NILKLPKVTHDAELIANLPENFDPRDK 175 K T+K G F T + K+ +GA + I K V N E + D Sbjct: 92 KNATYKLGLTKFTDLTNDEYRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKEVPETVD- 150 Query: 176 WPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPICGLGC 355 W + +N I+DQG+CGSCWAF A+ I + + S ++LV C GC Sbjct: 151 WRQKGAVNPIKDQGTCGSCWAFSTTAAVEGINKIVTG--ELISLSEQELVDCDKSYNQGC 208 Query: 356 NGGMPTLAWEY-WKHVGLVSGGNY 424 NGG+ A+++ K+ GL + +Y Sbjct: 209 NGGLMDYAFQFIMKNGGLNTEKDY 232 >At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol protease identical to SP|P43297 Cysteine proteinase RD21A precursor (EC 3.4.22.-) {Arabidopsis thaliana}, thiol protease RD21A SP:P43297 from [Arabidopsis thaliana] Length = 462 Score = 56.0 bits (129), Expect = 2e-08 Identities = 32/105 (30%), Positives = 52/105 (49%) Frame = +2 Query: 74 MGALKDDNILKLPKVTHDAELIANLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVE 253 +GA + + + ++A + LPE+ D W + + E++DQG CGSCWAF + Sbjct: 113 LGAKMEKKGERRTSLRYEARVGDELPESID----WRKKGAVAEVKDQGGCGSCWAFSTIG 168 Query: 254 AMTDRVCIYSNATKHFHFSAEDLVSCCPICGLGCNGGMPTLAWEY 388 A+ I + S ++LV C GCNGG+ A+E+ Sbjct: 169 AVEGINQIVTGDL--ITLSEQELVDCDTSYNEGCNGGLMDYAFEF 211 >At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol protease, putative similar to cysteine proteinase RD21A precursor (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 463 Score = 55.6 bits (128), Expect = 2e-08 Identities = 41/142 (28%), Positives = 68/142 (47%), Gaps = 2/142 (1%) Frame = +2 Query: 5 KQNTWKAG-RNFPTHTPFAHIKILMGALKDDNILKLPKVTHDAELIANLPENFDPRDKWP 181 K ++K G F T + + +GA +LK + A + LP++ D W Sbjct: 91 KNLSYKLGLTRFADLTNEEYRSMYLGAKPTKRVLKTSD-RYQARVGDALPDSVD----WR 145 Query: 182 ECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPICGLGCNG 361 + + +++DQGSCGSCWAF + A+ I + S ++LV C GCNG Sbjct: 146 KEGAVADVKDQGSCGSCWAFSTIGAVEGINKIVTGDL--ISLSEQELVDCDTSYNQGCNG 203 Query: 362 GMPTLAWEY-WKHVGLVSGGNY 424 G+ A+E+ K+ G+ + +Y Sbjct: 204 GLMDYAFEFIIKNGGIDTEADY 225 >At3g45310.1 68416.m04892 cysteine proteinase, putative similar to AALP protein GI:7230640 from [Arabidopsis thaliana] and barley aleurain Length = 358 Score = 55.6 bits (128), Expect = 2e-08 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 1/82 (1%) Frame = +2 Query: 161 DPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCC-P 337 D +D W E ++ +++QG CGSCW F A+ + K S + LV C Sbjct: 143 DTKD-WREDGIVSPVKEQGHCGSCWTFSTTGAL--EAAYHQAFGKGISLSEQQLVDCAGT 199 Query: 338 ICGLGCNGGMPTLAWEYWKHVG 403 GC+GG+P+ A+EY K+ G Sbjct: 200 FNNFGCHGGLPSQAFEYIKYNG 221 >At1g20850.1 68414.m02612 cysteine endopeptidase, papain-type (XCP2) identical to papain-type cysteine endopeptidase XCP2 GI:6708183 from [Arabidopsis thaliana] Length = 356 Score = 55.2 bits (127), Expect = 3e-08 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +2 Query: 176 WPECPTLNEIRDQGSCGSCWAFGAVEAMTD-RVCIYSNATKHFHFSAEDLVSCCPICGLG 352 W + + E+++QGSCGSCWAF V A+ + N T S ++L+ C G Sbjct: 144 WRKKGAVAEVKNQGSCGSCWAFSTVAAVEGINKIVTGNLTT---LSEQELIDCDTTYNNG 200 Query: 353 CNGGMPTLAWEY 388 CNGG+ A+EY Sbjct: 201 CNGGLMDYAFEY 212 >At4g35350.2 68417.m05022 cysteine endopeptidase, papain-type (XCP1) identical to papain-type cysteine endopeptidase XCP1 GI:6708181 from [Arabidopsis thaliana] Length = 288 Score = 54.8 bits (126), Expect = 4e-08 Identities = 30/84 (35%), Positives = 43/84 (51%) Frame = +2 Query: 137 IANLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAE 316 I +LP++ D R K P ++DQG CGSCWAF V A+ I + S + Sbjct: 134 ITDLPKSVDWRKKGAVAP----VKDQGQCGSCWAFSTVAAVEGINQITTGNLS--SLSEQ 187 Query: 317 DLVSCCPICGLGCNGGMPTLAWEY 388 +L+ C GCNGG+ A++Y Sbjct: 188 ELIDCDTTFNSGCNGGLMDYAFQY 211 >At4g35350.1 68417.m05023 cysteine endopeptidase, papain-type (XCP1) identical to papain-type cysteine endopeptidase XCP1 GI:6708181 from [Arabidopsis thaliana] Length = 355 Score = 54.8 bits (126), Expect = 4e-08 Identities = 30/84 (35%), Positives = 43/84 (51%) Frame = +2 Query: 137 IANLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAE 316 I +LP++ D R K P ++DQG CGSCWAF V A+ I + S + Sbjct: 134 ITDLPKSVDWRKKGAVAP----VKDQGQCGSCWAFSTVAAVEGINQITTGNLS--SLSEQ 187 Query: 317 DLVSCCPICGLGCNGGMPTLAWEY 388 +L+ C GCNGG+ A++Y Sbjct: 188 ELIDCDTTFNSGCNGGLMDYAFQY 211 >At5g50260.1 68418.m06224 cysteine proteinase, putative similar to cysteine endopeptidase precursor CysEP GI:2944446 from [Ricinus communis] Length = 361 Score = 53.6 bits (123), Expect = 9e-08 Identities = 28/76 (36%), Positives = 39/76 (51%) Frame = +2 Query: 176 WPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPICGLGC 355 W + + +++QG CGSCWAF V A+ I K S ++LV C GC Sbjct: 132 WRKNGAVTPVKNQGQCGSCWAFSTVVAVEGINQI--RTKKLTSLSEQELVDCDTNQNQGC 189 Query: 356 NGGMPTLAWEYWKHVG 403 NGG+ LA+E+ K G Sbjct: 190 NGGLMDLAFEFIKEKG 205 >At3g54940.3 68416.m06091 cysteine proteinase, putative contains similarity to cysteine proteinase GI:479060 from [Glycine max] Length = 368 Score = 53.2 bits (122), Expect = 1e-07 Identities = 33/98 (33%), Positives = 45/98 (45%), Gaps = 9/98 (9%) Frame = +2 Query: 137 IANLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAE 316 + LPE+FD W E + E+++QG+CGSCWAF A + + K S + Sbjct: 134 VDGLPEDFD----WREKGGVTEVKNQGACGSCWAFSTTGAAEG--AHFVSTGKLLSLSEQ 187 Query: 317 DLVSC---------CPICGLGCNGGMPTLAWEYWKHVG 403 LV C C GC GG+ T A+EY G Sbjct: 188 QLVDCDQAVFDPKDKKACDNGCGGGLMTNAYEYLMEAG 225 >At4g16190.1 68417.m02457 cysteine proteinase, putative contains similarity to papain-like cysteine proteinase isoform I GI:7381219 from [Ipomoea batatas] Length = 373 Score = 52.8 bits (121), Expect = 2e-07 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 12/119 (10%) Frame = +2 Query: 104 KLPKVTHDAELI--ANLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCI 277 +LP T A ++ ++LP FD W E + +++QG CGSCW+F A+ A+ Sbjct: 124 RLPTDTQTAPILPTSDLPTEFD----WREQGAVTPVKNQGMCGSCWSFSAIGALEG---A 176 Query: 278 YSNATKHF-HFSAEDLVSC---CP-----ICGLGCNGGMPTLAWEY-WKHVGLVSGGNY 424 + ATK S + LV C C C GC+GG+ A+EY K GL+ +Y Sbjct: 177 HFLATKELVSLSEQQLVDCDHECDPAQANSCDSGCSGGLMNNAFEYALKAGGLMKEEDY 235 >At5g45890.1 68418.m05644 senescence-specific SAG12 protein (SAG12) / cysteine proteinase, putative identical to senescence-specific protein SAG12 GI:1046373 from [Arabidopsis thaliana] Length = 346 Score = 52.4 bits (120), Expect = 2e-07 Identities = 31/84 (36%), Positives = 41/84 (48%), Gaps = 1/84 (1%) Frame = +2 Query: 176 WPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPICGLGC 355 W + + I++QGSCG CWAF AV A+ I K S + LV C GC Sbjct: 136 WRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKG--KLISLSEQQLVD-CDTNDFGC 192 Query: 356 NGGMPTLAWEYWKHV-GLVSGGNY 424 GG+ A+E+ K GL + NY Sbjct: 193 EGGLMDTAFEHIKATGGLTTESNY 216 >At1g09850.1 68414.m01109 cysteine protease, papain-like (XBCP3) identical to papain-like cysteine peptidase XBCP3 GI:14600257 from [Arabidopsis thaliana]; contains Pfam profiles PF00112: Papain family cysteine protease and PF00396: Granulin Length = 437 Score = 52.4 bits (120), Expect = 2e-07 Identities = 24/71 (33%), Positives = 37/71 (52%) Frame = +2 Query: 176 WPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPICGLGC 355 W + + ++DQGSCG+CW+F A AM I + S ++L+ C GC Sbjct: 124 WRKKGAVTNVKDQGSCGACWSFSATGAMEGINQIVTGDL--ISLSEQELIDCDKSYNAGC 181 Query: 356 NGGMPTLAWEY 388 NGG+ A+E+ Sbjct: 182 NGGLMDYAFEF 192 >At3g48350.1 68416.m05277 cysteine proteinase, putative similar to cysteine endopeptidase precursor [Ricinus communis] GI:2944446; contains Pfam profile PF00112: Papain family cysteine protease Length = 364 Score = 52.0 bits (119), Expect = 3e-07 Identities = 31/91 (34%), Positives = 46/91 (50%) Frame = +2 Query: 131 ELIANLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFS 310 E + +P + D W E + E+++Q CGSCWAF V A+ I +N K S Sbjct: 121 ENVTRVPSSVD----WREKGAVTEVKNQQDCGSCWAFSTVAAVEGINKIRTN--KLVSLS 174 Query: 311 AEDLVSCCPICGLGCNGGMPTLAWEYWKHVG 403 ++LV C GC GG+ A+E+ K+ G Sbjct: 175 EQELVDCDTEENQGCAGGLMEPAFEFIKNNG 205 >At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol protease, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 452 Score = 51.2 bits (117), Expect = 5e-07 Identities = 28/82 (34%), Positives = 43/82 (52%) Frame = +2 Query: 143 NLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDL 322 +LP+ D W +N ++DQGSCGSCWAF A+ A+ I + + S ++L Sbjct: 128 SLPDAID----WRAKGAVNPVKDQGSCGSCWAFSAIGAVEGINQIKTG--ELISLSEQEL 181 Query: 323 VSCCPICGLGCNGGMPTLAWEY 388 V C GC GG+ A+++ Sbjct: 182 VDCDTSYNDGCGGGLMDYAFKF 203 >At2g27420.1 68415.m03314 cysteine proteinase, putative contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas] Length = 348 Score = 50.8 bits (116), Expect = 7e-07 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 4/104 (3%) Frame = +2 Query: 143 NLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDL 322 N+ +N + D W + + ++ QG CG CWAF AV A+ I + S + L Sbjct: 124 NVSDNGESMD-WRQEGAVTPVKYQGRCGGCWAFSAVAAVEGITKITKG--ELVSLSEQQL 180 Query: 323 VSCCPICGLGCNGGMPTLAWEY-WKHVGLVSGGNY---NSSQGC 442 + C GC GG+ + A+EY K+ G+ + NY S Q C Sbjct: 181 LDCDRDYNQGCRGGIMSKAFEYIIKNQGITTEDNYPYQESQQTC 224 >At3g19400.2 68416.m02460 cysteine proteinase, putative non-consensus AT acceptor site at exon 3; contains similarity to cysteine protease CYP1 GI:2828252, TDI-65 GI:5726641 from [Lycopersicon esculentum] Length = 290 Score = 48.0 bits (109), Expect = 5e-06 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%) Frame = +2 Query: 146 LPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLV 325 LP+ D W + ++DQG+CGSCWAF AV A+ I + + S ++LV Sbjct: 130 LPDEVD----WRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTG--ELISLSEQELV 183 Query: 326 SC-CPICGLGCNGGMPTLAWEY-WKHVGLVSGGNY 424 C GC+GG+ A+E+ K+ G+ + +Y Sbjct: 184 DCDRGFVNAGCDGGIMNYAFEFIMKNGGIETDQDY 218 >At3g19400.1 68416.m02461 cysteine proteinase, putative non-consensus AT acceptor site at exon 3; contains similarity to cysteine protease CYP1 GI:2828252, TDI-65 GI:5726641 from [Lycopersicon esculentum] Length = 362 Score = 48.0 bits (109), Expect = 5e-06 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%) Frame = +2 Query: 146 LPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLV 325 LP+ D W + ++DQG+CGSCWAF AV A+ I + + S ++LV Sbjct: 130 LPDEVD----WRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTG--ELISLSEQELV 183 Query: 326 SC-CPICGLGCNGGMPTLAWEY-WKHVGLVSGGNY 424 C GC+GG+ A+E+ K+ G+ + +Y Sbjct: 184 DCDRGFVNAGCDGGIMNYAFEFIMKNGGIETDQDY 218 >At4g11310.1 68417.m01827 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 364 Score = 45.6 bits (103), Expect = 2e-05 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 1/94 (1%) Frame = +2 Query: 146 LPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLV 325 LP++ D W + E++DQG C SCWAF V A+ I + + S +DL+ Sbjct: 137 LPKSVD----WRNEGAVTEVKDQGHCRSCWAFSTVGAVEGLNKIVTG--ELVTLSEQDLI 190 Query: 326 SCCPICGLGCNGGMPTLAWEY-WKHVGLVSGGNY 424 +C GC GG A+E+ K+ GL + +Y Sbjct: 191 NCNKE-NNGCGGGKLETAYEFIMKNGGLGTDNDY 223 >At1g29090.1 68414.m03561 peptidase C1A papain family protein contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas]; contains Pfam profile PF00112: Papain family cysteine protease Length = 355 Score = 45.6 bits (103), Expect = 2e-05 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%) Frame = +2 Query: 176 WPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPICGLGC 355 W + ++ QG CG CWAF +V A+ I N S + L+ C GC Sbjct: 145 WRYEGAVTPVKYQGQCGCCWAFSSVAAVEGLTKIVGN--NLVSLSEQQLLDCDRERDNGC 202 Query: 356 NGGMPTLAWEY-WKHVGLVSGGNY 424 NGG+ + A+ Y K+ G+ S +Y Sbjct: 203 NGGIMSDAFSYIIKNRGIASEASY 226 >At1g06260.1 68414.m00662 cysteine proteinase, putative contains similarity to thiol-protease, pre-pro-TPE4A protein GI:3688528 [Pisum sativum] Length = 343 Score = 45.2 bits (102), Expect = 3e-05 Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 2/96 (2%) Frame = +2 Query: 143 NLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDL 322 N+P+ D W + IR+QG CG CWAF AV A+ I + S + L Sbjct: 126 NVPDAVD----WRTQGAVTPIRNQGKCGGCWAFSAVAAIEGINKIKTG--NLVSLSEQQL 179 Query: 323 VSC-CPICGLGCNGGMPTLAWEYWK-HVGLVSGGNY 424 + C GC+GG+ A+E+ K + GL + +Y Sbjct: 180 IDCDVGTYNKGCSGGLMETAFEFIKTNGGLATETDY 215 >At4g23520.1 68417.m03390 cysteine proteinase, putative contains similarity to cysteine proteinase (thiol protease) RD21A GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 356 Score = 44.8 bits (101), Expect = 4e-05 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = +2 Query: 146 LPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLV 325 LPE+ D W + ++EI+DQG+C SCWAF V A+ I + + S ++LV Sbjct: 133 LPESVD----WRQEGAVSEIKDQGTCNSCWAFSTVAAVEGLNKIVTG--ELISLSEQELV 186 Query: 326 SCCPICGLGCNG-GMPTLAWEY 388 C + GC G G+ A+++ Sbjct: 187 D-CNLVNNGCYGSGLMDTAFQF 207 >At1g29080.1 68414.m03560 peptidase C1A papain family protein contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas]; contains Pfam profile PF00112: Papain family cysteine protease Length = 346 Score = 44.8 bits (101), Expect = 4e-05 Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 1/84 (1%) Frame = +2 Query: 176 WPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPICGLGC 355 W + ++ QG CG CWAF A+ A+ I S + L+ C GC Sbjct: 136 WRNEGAVTPVKSQGECGGCWAFSAIAAVEGLTKIARG--NLISLSEQQLLDCTREQNNGC 193 Query: 356 NGGMPTLAWEY-WKHVGLVSGGNY 424 GG A+ Y KH G+ S Y Sbjct: 194 KGGTFVNAFNYIIKHRGISSENEY 217 >At2g34080.1 68415.m04172 cysteine proteinase, putative contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas] Length = 345 Score = 44.4 bits (100), Expect = 6e-05 Identities = 29/94 (30%), Positives = 44/94 (46%), Gaps = 4/94 (4%) Frame = +2 Query: 176 WPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLVSCCPICGLGC 355 W + ++ QG CG CWAF AV A+ I S + L+ C GC Sbjct: 136 WRAEGAVTPVKYQGQCGCCWAFSAVAAVEGVAKIAGG--NLVSLSEQQLLDCDREYDRGC 193 Query: 356 NGGMPTLAWEY-WKHVGLVSGGNYN---SSQGCR 445 +GG+ + A+ Y ++ G+ S +Y+ S GCR Sbjct: 194 DGGIMSDAFNYVVQNRGIASENDYSYQGSDGGCR 227 >At3g54940.2 68416.m06090 cysteine proteinase, putative contains similarity to cysteine proteinase GI:479060 from [Glycine max] Length = 211 Score = 44.0 bits (99), Expect = 8e-05 Identities = 23/65 (35%), Positives = 33/65 (50%) Frame = +2 Query: 137 IANLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAE 316 + LPE+FD W E + E+++QG+CGSCWAF A + + K S + Sbjct: 134 VDGLPEDFD----WREKGGVTEVKNQGACGSCWAFSTTGAAEG--AHFVSTGKLLSLSEQ 187 Query: 317 DLVSC 331 LV C Sbjct: 188 QLVDC 192 >At4g11320.1 68417.m01828 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 371 Score = 43.6 bits (98), Expect = 1e-04 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 1/94 (1%) Frame = +2 Query: 146 LPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLV 325 LP++ D W + E++DQG C SCWAF V A+ I + + S +DL+ Sbjct: 144 LPKSVD----WRNEGAVTEVKDQGLCRSCWAFSTVGAVEGLNKIVTG--ELVTLSEQDLI 197 Query: 326 SCCPICGLGCNGGMPTLAWEY-WKHVGLVSGGNY 424 +C GC GG A+E+ + GL + +Y Sbjct: 198 NCNKE-NNGCGGGKVETAYEFIMNNGGLGTDNDY 230 >At3g49340.1 68416.m05394 cysteine proteinase, putative contains PS00640: Eukaryotic thiol (cysteine) proteases asparagine active site; similar to cysteine proteinase GI:535454 from [Alnus glutinosam] Length = 341 Score = 42.3 bits (95), Expect = 2e-04 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 1/95 (1%) Frame = +2 Query: 143 NLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDL 322 N+ E + D W + + ++ Q CG CWAF AV A+ I + + S + L Sbjct: 123 NVGETGESMD-WIQEGAVTSVKHQQQCGCCWAFSAVAAVEGMTKIANG--ELVSLSEQQL 179 Query: 323 VSCCPICGLGCNGGMPTLAWEYWK-HVGLVSGGNY 424 + C GC GG+ A++Y K + G+ + NY Sbjct: 180 LDCSTE-NNGCGGGIMWKAFDYIKENQGITTEDNY 213 >At3g43960.1 68416.m04706 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 376 Score = 41.5 bits (93), Expect = 4e-04 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +2 Query: 146 LPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHFHFSAEDLV 325 LP+ D R++ P ++ QG CGSCWAF A A+ I + + S ++L+ Sbjct: 127 LPDEVDWRERGAVVP---RVKRQGECGSCWAFAATGAVEGINQITTG--ELVSLSEQELI 181 Query: 326 SC-CPICGLGCNGGMPTLAWEYWK-HVGLVSGGNY 424 C GC GG A+E+ K + G+VS Y Sbjct: 182 DCDRGNDNFGCAGGGAVWAFEFIKENGGIVSDEVY 216 >At3g48340.1 68416.m05276 cysteine proteinase, putative similar to cysteine endopeptidase precursor [Ricinus communis] GI:2944446; contains Pfam profile PF00112: Papain family cysteine protease Length = 351 Score = 37.1 bits (82), Expect = 0.009 Identities = 30/94 (31%), Positives = 46/94 (48%) Frame = +2 Query: 122 HDAELIANLPENFDPRDKWPECPTLNEIRDQGSCGSCWAFGAVEAMTDRVCIYSNATKHF 301 +D E ++ LP + D W + + EI++QG C AVE + I +N K Sbjct: 120 YDHENLSKLPSSVD----WRKKGAVTEIKNQGKC-------AVEGINK---IKTN--KLV 163 Query: 302 HFSAEDLVSCCPICGLGCNGGMPTLAWEYWKHVG 403 S ++LV C GCNGG+ +A+E+ K G Sbjct: 164 SLSEQELVDCDTKQNEGCNGGLMEIAFEFIKKNG 197 >At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein contains Pfam PF01422: NF-X1 type zinc finger; similar to transcriptional repressor NF-X1 (SP:Q12986) [Homo sapiens]; similar to EST gb|T21002 Length = 1188 Score = 28.7 bits (61), Expect = 3.0 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = +2 Query: 440 CRPYEIPPCEHHVPGNRMPCNGDTKTPKCQK 532 C P PPC+ P PC T +C + Sbjct: 343 CHPGPCPPCKAFAPPRSCPCGKKMVTTRCSE 373 >At5g54320.1 68418.m06765 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 369 Score = 27.9 bits (59), Expect = 5.3 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 6/69 (8%) Frame = -2 Query: 468 SHGGIS*GRQPWLEL*LPPDTSPTCFQYSQAKVGIPPLQPRPHIGQQ------LTRSSAE 307 SHG I+ Q L L D +P + ++ +PPL PH Q L+ SS E Sbjct: 92 SHGWIATLSQDDGLLRLQDDLNPVASDTNPKRIPLPPLVTLPHCQTQIVTNVSLSASSPE 151 Query: 306 KWKCLVALE 280 C+VA++ Sbjct: 152 DEDCVVAVK 160 >At4g31260.1 68417.m04437 hypothetical protein Length = 63 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 188 GIRATYPSGRNSLEGLLLAQHRESL*ATSIY 96 G+++ P GRNSLE L+A S+Y Sbjct: 2 GLKSKVPGGRNSLESFLIASKAAGSIIRSLY 32 >At5g55890.1 68418.m06967 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 366 Score = 27.1 bits (57), Expect = 9.3 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 6/69 (8%) Frame = -2 Query: 468 SHGGIS*GRQPWLEL*LPPDTSPTCFQYSQAKVGIPPLQPRPHIGQQ------LTRSSAE 307 SHG ++ Q L L D +P + ++ +PPL PH Q ++ SS E Sbjct: 88 SHGWVATLSQDDGILRLQDDLNPAASDTNPKRIPLPPLVTLPHCQTQIVTNVSMSSSSPE 147 Query: 306 KWKCLVALE 280 C+VA++ Sbjct: 148 DENCVVAVK 156 >At5g55880.1 68418.m06966 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 366 Score = 27.1 bits (57), Expect = 9.3 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 6/69 (8%) Frame = -2 Query: 468 SHGGIS*GRQPWLEL*LPPDTSPTCFQYSQAKVGIPPLQPRPHIGQQ------LTRSSAE 307 SHG ++ Q L L D +P + ++ +PPL PH Q ++ SS E Sbjct: 88 SHGWVATLSQDDGILRLQDDLNPAASDTNPKRIPLPPLVTLPHCQTQIVTNVSMSSSSPE 147 Query: 306 KWKCLVALE 280 C+VA++ Sbjct: 148 DENCVVAVK 156 >At5g54470.1 68418.m06783 zinc finger (B-box type) family protein similar to unknown protein (pir||T05755) Length = 215 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/51 (25%), Positives = 21/51 (41%) Frame = +2 Query: 329 CCPICGLGCNGGMPTLAWEYWKHVGLVSGGNYNSSQGCRPYEIPPCEHHVP 481 CC + + C +L W+ G V G N+ ++ R C+ H P Sbjct: 9 CCGVARMYCESDQASLCWDC---DGKVHGANFLVAKHMRCLLCSACQSHTP 56 >At1g61460.1 68414.m06925 S-locus protein kinase, putative contains similarity to KI domain interacting kinase 1 [Zea mays] gi|2735017|gb|AAB93834; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 598 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 377 AWEYWKHVGLVSGGNYNSSQGCRPYEIPPC 466 AWE W G V + + + CRP E+ C Sbjct: 502 AWESWCETGGVDLLDKDVADSCRPLEVERC 531 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,158,165 Number of Sequences: 28952 Number of extensions: 279406 Number of successful extensions: 849 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -