BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F05 (546 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 26 0.93 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 25.8 bits (54), Expect = 0.93 Identities = 21/81 (25%), Positives = 33/81 (40%), Gaps = 1/81 (1%) Frame = +3 Query: 111 DRMVFLSE-YVARMKPNQHHIYYIAGSSRAEVQRSPFAERLVRRGYEVLYLTEAVDEYCL 287 D VF E VAR+ + AG+ S ++ + ++E +D Y L Sbjct: 917 DGGVFQEEAIVARLTRPAPGVPGAAGTRNLSDNLSDLRAQIAANQKGIQLVSELIDAYGL 976 Query: 288 SSLPEYDGHKFQNIAEEIFDL 350 S + Y GH QN + D+ Sbjct: 977 SVVQAYMGHMQQNAELAVRDM 997 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 284,454 Number of Sequences: 2352 Number of extensions: 3104 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -