BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_F01 (564 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.28 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 29 2.6 SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) 29 3.5 SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_43460| Best HMM Match : Keratin_B2 (HMM E-Value=0.68) 28 4.6 SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) 28 6.1 SB_23914| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 32.3 bits (70), Expect = 0.28 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +2 Query: 20 ALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 199 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 200 YSQ 208 Y Q Sbjct: 240 YGQ 242 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 29.1 bits (62), Expect = 2.6 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 60 SISYITGLWVTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SHS-LTIANLMPLTV 227 ++++ T + +TLTHS++T + N S L L+ N +HS LT + L LT+ Sbjct: 1 TLTHPTLIHLTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 >SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) Length = 688 Score = 28.7 bits (61), Expect = 3.5 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 364 DLDNGISGNIGLNVDGN 314 ++D G+SGN LNVDG+ Sbjct: 397 NIDTGVSGNFSLNVDGS 413 >SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/99 (17%), Positives = 44/99 (44%), Gaps = 1/99 (1%) Frame = +2 Query: 206 QFDATNSVFLTKKEIKTSYPHNFKVRQPRLNHKPFSVTIDVKSDIATDAVIKIFLGPKYN 385 + D +SV + + + S + +++ ++ + + I V + + + I Y Sbjct: 273 ELDTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYV 332 Query: 386 DXGFPITL-EENWHKFYELDWFTHKITPGQNKIVRNSNE 499 G + L +W + ++L+W + K+ G+N + + E Sbjct: 333 VDGPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 371 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/99 (17%), Positives = 44/99 (44%), Gaps = 1/99 (1%) Frame = +2 Query: 206 QFDATNSVFLTKKEIKTSYPHNFKVRQPRLNHKPFSVTIDVKSDIATDAVIKIFLGPKYN 385 + D +SV + + + S + +++ ++ + + I V + + + I Y Sbjct: 756 ELDTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYV 815 Query: 386 DXGFPITL-EENWHKFYELDWFTHKITPGQNKIVRNSNE 499 G + L +W + ++L+W + K+ G+N + + E Sbjct: 816 VDGPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 854 >SB_43460| Best HMM Match : Keratin_B2 (HMM E-Value=0.68) Length = 306 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 8 FMPSALDFYQTALRDPAFYQLYNRIVGYINAF 103 F+P+ L F T+ D FY NR +G IN++ Sbjct: 13 FIPADLSFGITSFYDVYFYSPRNRSLGIINSY 44 >SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 413 ENWHKFYELDWFTHKITPGQNKIVRN 490 + WHK YELD F K + N I+RN Sbjct: 66 KEWHK-YELDKFMEKTSSYHNTILRN 90 >SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) Length = 474 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 137 LHFVGVKINDVVVEKLVTFFDYSQFDATNSV 229 LH G K++D VVE + F + +QF AT+ V Sbjct: 181 LHAQG-KVDDAVVESVREFLEANQFKATSDV 210 >SB_23914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -3 Query: 364 DLDNGISGNIGLNVDGNT--ERLVVES 290 ++D G+ GN LN+DG+ E+L+VE+ Sbjct: 340 NIDVGVGGNFTLNMDGSALIEKLLVET 366 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 27.5 bits (58), Expect = 8.0 Identities = 27/104 (25%), Positives = 40/104 (38%) Frame = +2 Query: 92 INAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQFDATNSVFLTKKEIKTSYPHN 271 + F+ L PYP ++HF VV + + D TNS F ++ P + Sbjct: 623 LTEFQTNLVPYP--RIHFPMASYAPVVSAEKAYHEQLTVADITNSCFEPANQMVKCDPRH 680 Query: 272 FKVRQPRLNHKPFSVTIDVKSDIATDAVIKIFLGPKYNDXGFPI 403 K L ++ V DV S IAT K + GF + Sbjct: 681 GKYMACCLLYRGDVVPKDVNSAIATIKTKKTIQFVDWCPTGFKV 724 >SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1495 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 406 CDGESXIVVLRSQEDLDNGISGNIG-LNVDGNTERLVVESW 287 C ES ++LR+ ED+ + GN+G LN+ T+ V SW Sbjct: 815 CGAESNELILRTFEDVPSVAPGNVGTLNLTSMTDLRV--SW 853 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,107,896 Number of Sequences: 59808 Number of extensions: 310881 Number of successful extensions: 772 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -