BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E24 (443 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 3.7 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 4.9 AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 23 4.9 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 4.9 AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprot... 23 6.4 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 3.7 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 32 CLKNFAKCLKPGGLLF-IDHRNYDAMIDSGATPGHSIYYN 148 C+ +F LKP LLF I N ++ S A P S Y+ Sbjct: 207 CISSFTLRLKPSDLLFVIGDFNQPSISWSTADPSSSPAYS 246 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.0 bits (47), Expect = 4.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 181 YRSLYVNWIFTIII 140 Y S+Y +W+F +II Sbjct: 372 YASVYSHWVFLVII 385 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 23.0 bits (47), Expect = 4.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 212 ALDYCIDTTSDEELNDKSEFRLCYYPHKLSKFTKMLDEAF 331 A D I + +L D+ F + PHKL+ FT+ L+ + Sbjct: 59 ASDSLIFLETARKLGDR--FDIVVAPHKLADFTETLESDY 96 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.0 bits (47), Expect = 4.9 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -2 Query: 364 VCIYVVLGTIVERLVK 317 +C+ VLG I+ERL++ Sbjct: 493 ICLLSVLGKILERLIQ 508 >AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprotein transferase protein. Length = 103 Score = 22.6 bits (46), Expect = 6.4 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -2 Query: 334 VERLVKHFCEF*QFMW 287 + R +HFCE+ + W Sbjct: 80 IVRCARHFCEYDDYNW 95 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 443,575 Number of Sequences: 2352 Number of extensions: 8328 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -