BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E24 (443 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 3.5 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 4.6 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 8.0 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 3.5 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +2 Query: 146 NCKYPVDIKTSVLVVSGKPKLIALDYCIDTTSDEELNDKSEF 271 N PV+ + +GKPK D D + +E + + EF Sbjct: 63 NYTTPVNFVAGGIQQAGKPKEETDDKDDDESDNENIKSQKEF 104 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 4.6 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -2 Query: 217 QRDQLWFPAHDEYRSL 170 Q ++ W P ++ Y+SL Sbjct: 438 QTNKTWLPVNENYKSL 453 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +2 Query: 332 DNRAKHHIYADFKSIHEVPVP 394 DN +Y + I ++PVP Sbjct: 99 DNNYNKKLYYNINYIEQIPVP 119 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,459 Number of Sequences: 438 Number of extensions: 2464 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -