BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E17 (487 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0862 - 7172083-7172931 32 0.21 10_01_0320 + 3506183-3507109 32 0.28 10_01_0322 + 3516922-3517899 31 0.65 11_02_0082 - 8088169-8088284,8088613-8088697,8090344-8090442,809... 30 0.86 10_01_0329 - 3599571-3600554 30 0.86 09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 30 0.86 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 30 0.86 05_04_0146 + 18393447-18394043 29 2.0 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 2.0 04_04_0765 - 27910189-27912393,27912521-27912598 29 2.0 03_06_0572 + 34812203-34812278,34812485-34813768,34813973-348140... 29 2.0 03_03_0145 + 14833043-14833113,14833544-14833662,14833834-148339... 29 2.0 08_02_0279 - 15249361-15249612,15251270-15251506,15252704-152527... 29 2.6 05_06_0278 + 26894802-26895362 29 2.6 01_07_0117 + 41171919-41172395 29 2.6 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 29 2.6 02_03_0279 + 17250347-17252098 28 3.5 12_02_0758 - 22858221-22858367,22859362-22859460,22859505-228595... 28 4.6 11_04_0227 + 15094941-15095445,15095773-15095865,15096209-150963... 28 4.6 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 28 4.6 09_06_0081 + 20745627-20748144,20748211-20748308 28 4.6 09_02_0082 - 4060018-4061604 28 4.6 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 28 4.6 07_01_0645 - 4807411-4807613,4808214-4808691 28 4.6 04_04_0690 - 27300048-27300929 28 4.6 07_03_1386 - 26192019-26192073,26192272-26192397,26192570-261926... 27 6.0 06_01_0636 + 4627533-4628546 27 6.0 03_03_0023 + 13839421-13840326 27 6.0 01_06_0781 + 31962661-31963089,31963174-31963228,31964310-319645... 27 6.0 01_06_0349 - 28613059-28614240 27 6.0 10_08_0870 - 21178136-21178534 27 8.0 10_08_0436 - 17910948-17911583,17914699-17914929 27 8.0 07_03_1430 - 26503732-26504754 27 8.0 07_03_0560 + 19479597-19480667 27 8.0 06_03_1004 - 26832638-26833183,26833373-26833569,26833636-268338... 27 8.0 04_04_0430 - 25153572-25154060 27 8.0 02_04_0056 + 19313422-19313967,19314035-19314168,19314263-193143... 27 8.0 >07_01_0862 - 7172083-7172931 Length = 282 Score = 32.3 bits (70), Expect = 0.21 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMRK 118 P PLPP ++PL+ P L PL P+ P P ++ Sbjct: 160 PLPLPPRKKPLLYPPPLPPKKKPLPPPSPPPQPPLPEKE 198 >10_01_0320 + 3506183-3507109 Length = 308 Score = 31.9 bits (69), Expect = 0.28 Identities = 19/52 (36%), Positives = 24/52 (46%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMRKQFYTQSFTNSYER 157 PAP PPA R +P + TAS T A RP R Y + + YE+ Sbjct: 6 PAPAPPASRKRAAAPDHEPTASRSSTPAAAAGAKRPRR---YALASVDDYEQ 54 >10_01_0322 + 3516922-3517899 Length = 325 Score = 30.7 bits (66), Expect = 0.65 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMRKQFYTQSFTNSYER 157 PAP PPA R +P + TA T T P A RP R Y + + YE+ Sbjct: 8 PAPAPPASRKRAAAPDDEPTA----TGSTTPAAKRPRR---YALASVDDYEQ 52 >11_02_0082 - 8088169-8088284,8088613-8088697,8090344-8090442, 8090537-8090609,8090694-8090804,8090901-8091074, 8091184-8091574,8091662-8092283,8092379-8093251, 8093294-8093800 Length = 1016 Score = 30.3 bits (65), Expect = 0.86 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +2 Query: 2 PAPLPPAQRPLIPS-PALDGTASPLRTSCTVPRAPRPMRKQ 121 PAP PP PL PS P P + T PRAP P Q Sbjct: 551 PAPSPPHD-PLAPSLPQAPAATPPQDPALTPPRAPTPTPPQ 590 >10_01_0329 - 3599571-3600554 Length = 327 Score = 30.3 bits (65), Expect = 0.86 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMRKQFYTQSFTNSYER 157 PAP PPA R +P + TA+ T A RP R Y + + YE+ Sbjct: 6 PAPAPPASRKRAAAPDDEPTATGSTTPAAAAGAKRPRR---YALASVDDYEQ 54 >09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 Length = 883 Score = 30.3 bits (65), Expect = 0.86 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRP 109 P P+PPA P IP+P++ P TVP A P Sbjct: 527 PIPMPPAPAPPIPTPSMPFPTVP-APPVTVPPATAP 561 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPA 49 PAP PP PL P+PA Sbjct: 299 PAPAPPVPTPLAPTPA 314 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 30.3 bits (65), Expect = 0.86 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMRKQFYTQS 136 P P PP R +P+P T +P R V AP P R T S Sbjct: 129 PPPPPPPARTPMPTPTPTPTPTPTRPPVPVWAAPLPARTPTPTPS 173 >05_04_0146 + 18393447-18394043 Length = 198 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMR 115 PA LPP+ P P P + A+ S + P AP P R Sbjct: 79 PASLPPSASP--PPPEREAAAAMAAASASPPWAPSPAR 114 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPL---RTSCTVPRAPRP 109 P P PP P P P SPL T+ T P AP P Sbjct: 81 PPPPPPRNSPSPPKPPSQAAQSPLPPTTTTTTPPTAPVP 119 >04_04_0765 - 27910189-27912393,27912521-27912598 Length = 760 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 8 PLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMRKQ 121 P PP P+ PS + GT+ P RT+CT P +R + Sbjct: 555 PSPPRVSPVPPSASGAGTSLP-RTTCTPPTGGEWLRPE 591 >03_06_0572 + 34812203-34812278,34812485-34813768,34813973-34814049, 34814299-34814646 Length = 594 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +2 Query: 8 PLPPAQRPL-IPSPALDGTASPLRTSCTVPRAPRPMRKQFYTQSFTN 145 PL P P+ +P P T +P T P P P+ T + TN Sbjct: 295 PLYPEPTPVTMPDPTTTTTPTPFMNPVTAPTMPSPVTNPATTPAVTN 341 >03_03_0145 + 14833043-14833113,14833544-14833662,14833834-14833991, 14834147-14834587 Length = 262 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMRKQ 121 P + P+Q+P+ PSP T PL+ P P +Q Sbjct: 167 PGTVFPSQQPMQPSPMTTSTVFPLQQPLPQPTVIEPSARQ 206 >08_02_0279 - 15249361-15249612,15251270-15251506,15252704-15252772, 15252845-15252895,15254009-15254056,15254187-15254267, 15256219-15256257,15256486-15256551,15258113-15258236, 15258576-15258696,15258771-15258900,15259692-15259853 Length = 459 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +2 Query: 14 PPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMRKQF--YTQSFTNSY 151 PP R P PA DG A P + V P P Y + +T ++ Sbjct: 39 PPVLRHSQPEPAADGEAHPTSSKKNVQEIPTPQYDDVDTYERDYTRTF 86 >05_06_0278 + 26894802-26895362 Length = 186 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 5 APLPP-AQRPLIPSPALDGTASPLRTSCTVPRAPRP 109 AP PP + RP+ P +DG S R P +P+P Sbjct: 79 APPPPQSNRPVTPLAGVDGGVSGGRAPTNTPPSPQP 114 >01_07_0117 + 41171919-41172395 Length = 158 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +2 Query: 2 PAP-LPPAQRPLIPSPA--LDGTA-SPLRTSCTVPRAPRP 109 PAP L P PL+PSP DG+A +P T+P +P P Sbjct: 65 PAPALSPDIMPLLPSPGPDSDGSAEAPSDVMPTIPSSPSP 104 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 28.7 bits (61), Expect = 2.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRP 109 P P PP P+ P+ ++ + P + ++P +PRP Sbjct: 81 PPPPPPPPVPVPPAYSVTSSVPPYSMTSSLPPSPRP 116 >02_03_0279 + 17250347-17252098 Length = 583 Score = 28.3 bits (60), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASP 70 P P PP PL P LD TA P Sbjct: 127 PPPPPPPPPPLFAKPDLDSTAPP 149 >12_02_0758 - 22858221-22858367,22859362-22859460,22859505-22859557, 22859674-22859728,22860204-22860284,22860779-22861213 Length = 289 Score = 27.9 bits (59), Expect = 4.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 5 APLPPAQRPLIPSPALDGTASPLRTSCTVPRA 100 +P+P Q P + +PA T++PL + T+P A Sbjct: 48 SPVPRFQNPNLQAPAAHYTSTPLTSCHTLPAA 79 >11_04_0227 + 15094941-15095445,15095773-15095865,15096209-15096308, 15096799-15096874,15099906-15100017,15100924-15101012, 15101137-15101223,15101623-15101678,15102114-15102462 Length = 488 Score = 27.9 bits (59), Expect = 4.6 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 5 APLPPAQRPLIPSPALDGTASP 70 APLPPA P +PSP TASP Sbjct: 444 APLPPATPPRVPSP----TASP 461 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRP 109 P P PP L+PSP P+ + +VP P P Sbjct: 588 PPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPP 623 >09_06_0081 + 20745627-20748144,20748211-20748308 Length = 871 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTV-PRAPRP 109 P P+PP L+P+P G + + TV P RP Sbjct: 360 PVPMPPTPTRLVPTPPAPGPPADVPPRFTVSPTTTRP 396 >09_02_0082 - 4060018-4061604 Length = 528 Score = 27.9 bits (59), Expect = 4.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASP 70 P P+PPA P +P+P++ P Sbjct: 418 PIPMPPAPAPPVPTPSMPSPTVP 440 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALD 55 PAP PP PL P+P D Sbjct: 188 PAPAPPVPTPLAPAPPAD 205 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 27.9 bits (59), Expect = 4.6 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 2 PAPLPPAQRPLIPS--PALDGTASPLRTSCTVPRAPRPM 112 P+ PP Q PL PS PA PL S P P P+ Sbjct: 1150 PSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPL 1188 >07_01_0645 - 4807411-4807613,4808214-4808691 Length = 226 Score = 27.9 bits (59), Expect = 4.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 11 LPPAQRPLIPSPALDGTASPLRTSCTVPRAPRPMRKQFYTQSFTNSYERS 160 +PP PL+ + A+ +A+ P +P P ++F+ FTN + S Sbjct: 1 MPPPPPPLLLAAAVLASAAAALADPPPPPSPTPWPERFHAVLFTNLTQTS 50 >04_04_0690 - 27300048-27300929 Length = 293 Score = 27.9 bits (59), Expect = 4.6 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 108 GRGAR-GTVHDVRSGEAVPSSAGDGISGRWAGGSGAG 1 G GA+ G R+G A S AG + G AGGS AG Sbjct: 70 GAGAKVGVATGARTG-AASSGAGADVGGAVAGGSAAG 105 >07_03_1386 - 26192019-26192073,26192272-26192397,26192570-26192622, 26192722-26192807,26192896-26193017,26193096-26193155, 26193787-26193866,26193949-26194087,26194273-26194367, 26194792-26194860,26195015-26195131,26195839-26195913, 26196590-26196961 Length = 482 Score = 27.5 bits (58), Expect = 6.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 102 GARGTVHDVRSGEAVPSSAGDGISGRWAGGSGAG 1 GA R G + S G G GR GG GAG Sbjct: 3 GAEEEAAAARGGGSGSESGGSGGGGRGGGGGGAG 36 >06_01_0636 + 4627533-4628546 Length = 337 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRAP 103 P PLPPA +P G PL ++ P P Sbjct: 28 PLPLPPAATTTTSAPPAGGAMHPLASAGAAPPPP 61 >03_03_0023 + 13839421-13840326 Length = 301 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTASPLRTSCTVPRA 100 PAP P + L+PSP++ A+ + + VP A Sbjct: 46 PAPAPAPEHVLLPSPSVAAGAAEVLLAAGVPPA 78 >01_06_0781 + 31962661-31963089,31963174-31963228,31964310-31964557, 31965080-31965281,31965793-31965912,31965976-31966100, 31966182-31966288,31966726-31966792 Length = 450 Score = 27.5 bits (58), Expect = 6.0 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +2 Query: 2 PAP-LPPAQRPLIPSPALDGTASPLRTSCTVPRA--PRPMRK 118 P+P LPP SP + SPLR + +P A PRP R+ Sbjct: 82 PSPGLPPLPSRRSSSPFAISSPSPLRPAAAMPPADLPRPPRR 123 >01_06_0349 - 28613059-28614240 Length = 393 Score = 27.5 bits (58), Expect = 6.0 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -2 Query: 114 RMGRGARGTVHDVRSGEAVPSSAGDGISGRWAGGSG 7 RMG GA V G S +G + G GG+G Sbjct: 36 RMGSGASAVVDAAEPGAEADSGSGGRVCGGGGGGAG 71 >10_08_0870 - 21178136-21178534 Length = 132 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTAS 67 P+P PPA RP P+P G +S Sbjct: 26 PSPKPPAPRPKPPTPHYGGGSS 47 >10_08_0436 - 17910948-17911583,17914699-17914929 Length = 288 Score = 27.1 bits (57), Expect = 8.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 5 APLPPAQRPLIPSPALDGTASPLRTSCTVPRAPRP 109 +PL R + + AL G S SCTV R P P Sbjct: 247 SPLSHGFRAMCAATALGGGNSTAAASCTVVRIPSP 281 >07_03_1430 - 26503732-26504754 Length = 340 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 159 DRS*EFVNDCV*NCFRMGRGARG 91 DR+ E V D V N R GRG RG Sbjct: 46 DRAEEIVRDAVKNAIRGGRGDRG 68 >07_03_0560 + 19479597-19480667 Length = 356 Score = 27.1 bits (57), Expect = 8.0 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 108 GRGARGTVHDVRSGEAVPSSAGDGISGRWAGGSGAG 1 GRG G HD R G G G G + GG G G Sbjct: 46 GRGP-GFGHDCRFGRCRGGGGGFGGDGGFGGGGGGG 80 >06_03_1004 - 26832638-26833183,26833373-26833569,26833636-26833861, 26833943-26834072,26835884-26836188 Length = 467 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 114 RMGRGARGTVHDVRSGEAVPSSAGDGISGRWAGGSG 7 ++GR A G + +R+GE +P GR GG G Sbjct: 44 QLGR-ATGRMRKLRAGERIPGGGRPPARGREGGGGG 78 >04_04_0430 - 25153572-25154060 Length = 162 Score = 27.1 bits (57), Expect = 8.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 2 PAPLPPAQRPLIPSPALDGTA 64 P+P PP RP P P+ D A Sbjct: 130 PSPPPPPPRPATPPPSFDDAA 150 >02_04_0056 + 19313422-19313967,19314035-19314168,19314263-19314398, 19314870-19314923,19314995-19315135,19315220-19315546, 19315647-19315916,19316080-19316226,19316890-19317045, 19317223-19317290,19318210-19318309,19318696-19318985, 19319074-19319274,19319840-19319902,19320263-19320356, 19320964-19321035,19321979-19322077,19322254-19322376 Length = 1006 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 2 PAPLPPAQRPLIPSP-ALDGTASPLRTSCTVPRAPRP 109 P+P PPA +P P P + T +P R+ A +P Sbjct: 62 PSPSPPAGKPTKPHPESTPPTKTPARSKPAAAAAEKP 98 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,435,775 Number of Sequences: 37544 Number of extensions: 234648 Number of successful extensions: 1499 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1471 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 999806640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -