BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E15 (490 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0268 - 1941515-1941534,1941868-1942057,1942155-1942322,194... 27 6.1 11_03_0131 + 10497674-10499617 27 6.1 >12_01_0268 - 1941515-1941534,1941868-1942057,1942155-1942322, 1943425-1943568,1944284-1944443,1944512-1944621, 1944900-1945019,1945649-1945766,1946610-1946729, 1947228-1947285,1947590-1947723,1949332-1949414, 1949544-1949786,1949851-1949976,1950075-1951562 Length = 1093 Score = 27.5 bits (58), Expect = 6.1 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -2 Query: 378 LIQKKGLISFFAKDSIKLLVIVSQSLEFFFNPLS 277 L+ KG++S+F DS + L + Q+LE +FN LS Sbjct: 301 LLNHKGVVSYFRIDSSRSLNL--QTLETWFNILS 332 >11_03_0131 + 10497674-10499617 Length = 647 Score = 27.5 bits (58), Expect = 6.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 315 VSQSLEFFFNPLSTNLGFTPAFHCLPIVS 229 + L F + +S GF F CLPI+S Sbjct: 69 IRSHLRFCLDSISGRRGFKKGFRCLPIIS 97 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,010,345 Number of Sequences: 37544 Number of extensions: 170662 Number of successful extensions: 315 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -