BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E15 (490 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 7.0 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 21 9.3 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.0 bits (42), Expect = 7.0 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +3 Query: 336 NPLQKNLLSLSFELTSVYSDLT*VKINFLNVTI 434 NP ++ LS ++T ++ + +N +N+TI Sbjct: 112 NPYDRDSLSCWLQMTKHHNFIKVCSVNDVNMTI 144 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 20.6 bits (41), Expect = 9.3 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +2 Query: 215 ITHKNETIGKQWKAGVKPRLVLKGLKKNSNDCETMTNSFMESFAKKLIK 361 I KN + Q PR + KK N C+++ N A +L+K Sbjct: 68 ILDKNAEVDVQKALRHLPRSMQDSTKKLFNKCKSIQNEDPCEKAYQLVK 116 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,054 Number of Sequences: 438 Number of extensions: 2769 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -