BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E15 (490 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66820.1 68418.m08425 expressed protein 29 1.3 At3g21760.1 68416.m02745 UDP-glucoronosyl/UDP-glucosyl transfera... 28 2.9 At5g48410.1 68418.m05986 glutamate receptor family protein (GLR1... 28 3.9 At4g15270.1 68417.m02339 glucosyltransferase-related contains so... 28 3.9 At4g15260.1 68417.m02338 UDP-glucoronosyl/UDP-glucosyl transfera... 28 3.9 At4g04670.1 68417.m00683 Met-10+ like family protein / kelch rep... 28 3.9 At3g21780.1 68416.m02747 UDP-glucoronosyl/UDP-glucosyl transfera... 27 5.1 At4g15280.1 68417.m02340 UDP-glucoronosyl/UDP-glucosyl transfera... 27 6.8 At2g29740.1 68415.m03614 UDP-glucoronosyl/UDP-glucosyl transfera... 27 9.0 >At5g66820.1 68418.m08425 expressed protein Length = 519 Score = 29.5 bits (63), Expect = 1.3 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -2 Query: 351 FFAKDSIKLLVIVSQSLEFFFNPLSTNLGFTPAFHCLPIVSFLWVIDILNEFNIPSY 181 FF+ K L I S FFF+ G + AFHCL ++S L + + N+ Y Sbjct: 2 FFSDMERKTLAITPPS--FFFHLGGGAFGSSKAFHCLLLLSCLLLSSVNTLHNLAEY 56 >At3g21760.1 68416.m02745 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 485 Score = 28.3 bits (60), Expect = 2.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 225 LWVIDILNEFNIPSYNIYIS 166 + +ID+ NEF +PSY Y S Sbjct: 126 MMMIDVANEFGVPSYMFYTS 145 >At5g48410.1 68418.m05986 glutamate receptor family protein (GLR1.3) plant glutamate receptor family, PMID:11379626 Length = 860 Score = 27.9 bits (59), Expect = 3.9 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = -2 Query: 348 FAKDSIKLLVIVSQSLEFFFNPLSTNLGFTPAFHCLPIVSFLWVID 211 F + + ++ + +S+ FF PL+ +L T AF + +W+I+ Sbjct: 534 FTEMGLGIVAVKERSMWVFFQPLTPDLWITSAFFFVLTGVIVWLIE 579 >At4g15270.1 68417.m02339 glucosyltransferase-related contains some similarity to glucosyltransferase GI:14349251 from [Nicotiana tabacum] Length = 311 Score = 27.9 bits (59), Expect = 3.9 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 219 VIDILNEFNIPSYNIYIS 166 +ID++NEF +P Y +Y S Sbjct: 125 MIDVVNEFGVPCYMVYTS 142 >At4g15260.1 68417.m02338 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 359 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 219 VIDILNEFNIPSYNIYIS 166 +IDI NEF +P Y IY S Sbjct: 6 MIDIANEFGVPCYMIYTS 23 >At4g04670.1 68417.m00683 Met-10+ like family protein / kelch repeat-containing protein contains Pfam profiles PF01344: Kelch motif, PF02475: Met-10+ like-protein Length = 995 Score = 27.9 bits (59), Expect = 3.9 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +2 Query: 221 HKNETIGKQWKAGVKPRLVLKGLKKNSNDCETMTNSFMESFAKKLIKPFF 370 H+ + +GK ++ + L KGL C N E AKKLI F Sbjct: 651 HEKQLLGKDFERSEENNLT-KGLSLKDISCSAALNLLKEHGAKKLINVAF 699 >At3g21780.1 68416.m02747 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 431 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 219 VIDILNEFNIPSYNIYIS 166 +ID+ NEF +PSY Y S Sbjct: 70 MIDVANEFGVPSYLFYTS 87 >At4g15280.1 68417.m02340 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 478 Score = 27.1 bits (57), Expect = 6.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 219 VIDILNEFNIPSYNIYIS 166 +ID+ NEF +P Y +Y S Sbjct: 124 MIDVANEFGVPCYMVYTS 141 >At2g29740.1 68415.m03614 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 474 Score = 26.6 bits (56), Expect = 9.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 267 GFTPAFHCLPIVSFLWVIDILNEFNIPSY 181 G F C+P+ ID+ NEFN+PSY Sbjct: 127 GLVLDFFCVPL------IDVGNEFNLPSY 149 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,046,614 Number of Sequences: 28952 Number of extensions: 166278 Number of successful extensions: 369 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -