BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E13 (642 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0014 + 18392622-18392834,18393064-18393147,18393709-183937... 30 1.8 10_08_1005 - 22179407-22180122,22180210-22180653,22180737-221808... 27 9.6 >11_05_0014 + 18392622-18392834,18393064-18393147,18393709-18393797, 18393889-18394063,18394370-18394489,18394591-18394677, 18394755-18394826,18395166-18395279,18395387-18395487, 18395576-18395669,18395794-18395961,18396287-18396352, 18396475-18396531,18396708-18396927,18397015-18397151, 18397573-18397641,18397722-18397781,18397927-18397998, 18398171-18398218,18398376-18398495,18398743-18398808, 18399341-18399453,18399821-18399905,18400246-18400356, 18400436-18400531,18401075-18401143,18401235-18401453 Length = 974 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 201 YYFRLVYQLGNQRRKTTKLEIL*HGAPSYRISSFVFVKFLTAN 73 Y+FR+ YQ + R+ T +LE++ G+ ++ S+ +F N Sbjct: 194 YFFRIDYQDRDTRKGTKELEVVWRGSKTFGSSADIFAGIFPKN 236 >10_08_1005 - 22179407-22180122,22180210-22180653,22180737-22180861, 22180939-22181169,22181250-22181805,22181896-22182312, 22182405-22183216,22183653-22183738,22184464-22184534, 22184553-22185573,22186018-22186062,22186252-22186326, 22186797-22186871 Length = 1557 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -2 Query: 155 PRSLRSYNTERRVIGSQASCSLNS*QLTFPLLNSIPL--DERSLLD 24 P S Y ++ G ++CS QLT L+ IPL D+ + LD Sbjct: 1398 PDSSSIYKRQKTSEGKYSTCSFGDGQLTSKCLSKIPLPADQHTSLD 1443 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,647,307 Number of Sequences: 37544 Number of extensions: 243147 Number of successful extensions: 490 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -