BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E08 (515 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 4e-12 SB_48525| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 58 3e-09 SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 54 9e-08 SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 48 6e-06 SB_28009| Best HMM Match : Zfx_Zfy_act (HMM E-Value=7.3) 31 0.56 SB_8405| Best HMM Match : PAN (HMM E-Value=0.044) 31 0.74 SB_29945| Best HMM Match : DUF125 (HMM E-Value=1.7) 30 0.98 SB_37668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_4921| Best HMM Match : Myosin_head (HMM E-Value=7.39998e-41) 29 1.7 SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) 29 2.3 SB_8858| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_4707| Best HMM Match : Toxin_17 (HMM E-Value=8.2) 28 4.0 SB_39949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_43930| Best HMM Match : ANF_receptor (HMM E-Value=0) 27 6.9 SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_56079| Best HMM Match : RnaseH (HMM E-Value=8.1) 27 9.2 SB_74| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 68.1 bits (159), Expect = 4e-12 Identities = 47/148 (31%), Positives = 71/148 (47%) Frame = +1 Query: 1 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKLI 180 G P++K+ LGI GR++ L + ++ P A KGG+ GPYTK G ++Y EIC Sbjct: 249 GMPSNKIALGIPLYGRSFTLKTANKTLDAP---ATKGGQ-GPYTKEAGYIAYFEIC---- 300 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKASYVKTKNLG 360 + L DP Y + + WV Y+D + K +Y+K K+L Sbjct: 301 -------KMGLSVTRDPVL-VSPYGVDVNNQ------WVGYDDVTSVQEKVNYIKKKSLL 346 Query: 361 GVSIMDLSMDDFRGLCTGDKYPILRAAK 444 G + +DDF+G C YP++ A K Sbjct: 347 GAMFWAMDLDDFKGDCGQGSYPLMTAVK 374 >SB_48525| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 569 Score = 58.4 bits (135), Expect = 3e-09 Identities = 46/150 (30%), Positives = 66/150 (44%), Gaps = 2/150 (1%) Frame = +1 Query: 1 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKLI 180 GAP K+ LG+ T GR +KL +D G+ A+ G YT+ G L+Y EIC Sbjct: 362 GAPASKIALGLGTYGRAFKL-ADQTRHGL-KAPANGNPTRGQYTREPGFLAYYEIC---- 415 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKAS-YVKTKNL 357 K+N + A + P H G WV Y+D + K +K K + Sbjct: 416 ------------KMNLQVTSTESSAVKAPYGH-VGDLWVGYDDEYSLSLKVERVIKAKGM 462 Query: 358 GGVSIMDLSMDDFRG-LCTGDKYPILRAAK 444 G + +DDF+G C YP++ A K Sbjct: 463 AGAMFWAIPLDDFKGQFCGKGPYPLINAVK 492 >SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 829 Score = 53.6 bits (123), Expect = 9e-08 Identities = 46/150 (30%), Positives = 67/150 (44%), Gaps = 2/150 (1%) Frame = +1 Query: 1 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKLI 180 G P +K+VLG+ T GR + L+S + G +AG YT +G L+Y EIC + Sbjct: 648 GMPANKIVLGLGTYGRAFGLESAG----------NNGLDAGKYTGAKGFLAYFEICKMGL 697 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKASYVKTKN-L 357 +N K Y ++ G WV +++P + K V KN L Sbjct: 698 TVVENNKAK------------APYGYK-------GHDWVGFDNPKSLIYKIDNVVKKNQL 738 Query: 358 GGVSIMDLSMDDFRG-LCTGDKYPILRAAK 444 GV + +DDF G C KYP++ A K Sbjct: 739 RGVMFWAIDLDDFSGEHCGQGKYPLMSAVK 768 Score = 47.2 bits (107), Expect = 8e-06 Identities = 36/114 (31%), Positives = 52/114 (45%), Gaps = 2/114 (1%) Frame = +1 Query: 109 GGEAGPYTKVQGLLSYPEICAKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGG 288 G +G YT +G L+Y EIC + + H K N P Y ++ G Sbjct: 277 GVHSGKYTDAEGFLAYYEICKRGLTV------VHKNKANAP------YGYK-------GK 317 Query: 289 FWVSYEDPDTAGNKASYVKTKN-LGGVSIMDLSMDDFRG-LCTGDKYPILRAAK 444 W+ ++DP++ K V KN L GV + +DDF G C KYP++ A K Sbjct: 318 DWIGFDDPNSLVYKIDNVVKKNQLRGVMFWAIDLDDFSGEHCGQGKYPLMSAVK 371 >SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 807 Score = 48.4 bits (110), Expect = 3e-06 Identities = 37/151 (24%), Positives = 67/151 (44%) Frame = +1 Query: 1 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKLI 180 G P K+ LG++ G ++L ++ + P + +KG + PY E+C Sbjct: 631 GMPCGKIALGMANYGHAFELSDPTKTALGAPANVNKG-RSYPYY---------ELC---- 676 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKASYVKTKNLG 360 K P + ++P+K Y + G W++Y+D + G K +K +NL Sbjct: 677 ------KLPLTKVTDNPAK--APYGYH-------GSQWIAYDDVTSLGRKVELIKKENLL 721 Query: 361 GVSIMDLSMDDFRGLCTGDKYPILRAAKYRL 453 G + +DDF +C +P++ A +Y L Sbjct: 722 GAMFWAIDLDDFGNVCGQGAHPLMGAVRYML 752 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 47.6 bits (108), Expect = 6e-06 Identities = 35/110 (31%), Positives = 48/110 (43%), Gaps = 2/110 (1%) Frame = +1 Query: 121 GPYTKVQGLLSYPEICAKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVS 300 GPYT+ G LSY EIC + P + +V P Y + + D + WV Sbjct: 16 GPYTRESGFLSYYEICDMM--PKMKTMKTDQSEVRAP------YGY-VKQDWAD--VWVG 64 Query: 301 YEDPDTAGNKA-SYVKTKNLGGVSIMDLSMDDFRG-LCTGDKYPILRAAK 444 Y+D + K +K K L G L +DDF G C YP++ A K Sbjct: 65 YDDERSLQLKVEEVIKAKGLAGAMFWALDLDDFDGSSCGKGNYPLMNAVK 114 >SB_28009| Best HMM Match : Zfx_Zfy_act (HMM E-Value=7.3) Length = 677 Score = 31.1 bits (67), Expect = 0.56 Identities = 24/100 (24%), Positives = 42/100 (42%) Frame = +1 Query: 103 DKGGEAGPYTKVQGLLSYPEICAKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGE 282 D GE Y + S+ E ++ + +G++ + D TY L D HGE Sbjct: 146 DSHGEKATYILLDD--SHAEKATYILLGDSHGEKATYILLGDSHAEKATYIL-LDDSHGE 202 Query: 283 GGFWVSYEDPDTAGNKASYVKTKNLGGVSIMDLSMDDFRG 402 ++ +D + G KA+Y+ + G + +DD G Sbjct: 203 KATYILLDD--SHGEKATYILLDDSHGEKATYILLDDSHG 240 Score = 30.7 bits (66), Expect = 0.74 Identities = 24/100 (24%), Positives = 43/100 (43%) Frame = +1 Query: 103 DKGGEAGPYTKVQGLLSYPEICAKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGE 282 D GE Y + S+ E ++ + +G++ ++D TY L D HGE Sbjct: 172 DSHGEKATYILLGD--SHAEKATYILLDDSHGEKATYILLDDSHGEKATYIL-LDDSHGE 228 Query: 283 GGFWVSYEDPDTAGNKASYVKTKNLGGVSIMDLSMDDFRG 402 ++ +D + G KA+Y+ + G + +DD G Sbjct: 229 KATYILLDD--SHGEKATYILLDDSHGEKATYILLDDSHG 266 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/100 (24%), Positives = 42/100 (42%) Frame = +1 Query: 103 DKGGEAGPYTKVQGLLSYPEICAKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGE 282 D GE Y + S+ E A ++ + +G++ ++D Y L D HGE Sbjct: 445 DSHGEKATYILLDD--SHAEKAAYILLDDSHGEKATYILLDDSHAEKAAYIL-LDDSHGE 501 Query: 283 GGFWVSYEDPDTAGNKASYVKTKNLGGVSIMDLSMDDFRG 402 ++ D + G KA+Y+ + G + +DD G Sbjct: 502 KATYILLGD--SHGEKATYILLDDSHGEKATYILLDDSHG 539 >SB_8405| Best HMM Match : PAN (HMM E-Value=0.044) Length = 387 Score = 30.7 bits (66), Expect = 0.74 Identities = 30/122 (24%), Positives = 46/122 (37%), Gaps = 6/122 (4%) Frame = +1 Query: 1 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPI---HADKGGEAGPYTKVQGLLSYPEICA 171 G P +L LG+ T W IS + I H + G + + S C Sbjct: 224 GTPFDRLCLGMKNTTTNWIAVPHEGISLLTLIKKQHTQTSLDVGTWKSLLPGSSLQTGCY 283 Query: 172 KL---INPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKASYV 342 K + N + + PS+ G R+ G GG+W +D ++ GN+A Sbjct: 284 KQGFNVTSGINSATARIGILAFPSECSGHALSRI--GFGTGGYWYGQDDENSCGNEADTS 341 Query: 343 KT 348 KT Sbjct: 342 KT 343 >SB_29945| Best HMM Match : DUF125 (HMM E-Value=1.7) Length = 608 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/60 (23%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = -2 Query: 412 QCKDH-ENHPWKGP*WTHRQGSLFSRN*LCFRPCQDLRKKPRSHLHHDHQEGGRHRSQNV 236 Q + H H W W H + ++R + + R PR H +H++ G H +++ Sbjct: 255 QTRTHARRHAW----WEHEKAGTYTRRYIHRKDMAQTRTHPRRHAWREHKKAGTHTRRHM 310 >SB_37668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 250 YAFRLPDDHGEGGFWVSYEDPDTAGNKASYVKTKNLGGVSI 372 + ++ PD +G V+YEDP TA + K+ G SI Sbjct: 208 WIYKHPDGSSKGECTVTYEDPPTASAAIEWFNGKDFMGQSI 248 >SB_4921| Best HMM Match : Myosin_head (HMM E-Value=7.39998e-41) Length = 1017 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -3 Query: 336 TSFVSGRVRIFVRNPEATFTMIIRKAEGI 250 T + GR +IF+RNP F + ++ +G+ Sbjct: 640 TEYAYGRTKIFIRNPRTLFALEEKRKDGM 668 >SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) Length = 2440 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 289 FWVSYEDPDTAGNKASYVKTKNLGGVSIMDLSMD 390 F VS+++PD N + VK+K+ ++DLS D Sbjct: 1796 FEVSFDEPDVITNMKTKVKSKDTVRKDLLDLSSD 1829 >SB_8858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 886 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +2 Query: 86 FHRYTPIRVVKLVLIPKFKVY*ATQKFAPNLLTPTKTESVLIFVR 220 F RY P+R KL++ ++ TQ P + +++F R Sbjct: 523 FTRYNPVRYAKLIVFTRYNPVRYTQLMVFTRYNPVRYAQLMVFTR 567 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/57 (21%), Positives = 26/57 (45%) Frame = +2 Query: 50 RGSSIQTVKFPEFHRYTPIRVVKLVLIPKFKVY*ATQKFAPNLLTPTKTESVLIFVR 220 R + ++ + F RY P+R +L++ ++ TQ P + +++F R Sbjct: 180 RYNPVRYTQLMVFTRYNPVRYTQLIVFTRYNPVRYTQLIVFTRYNPVRYTQLIVFTR 236 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/57 (21%), Positives = 27/57 (47%) Frame = +2 Query: 50 RGSSIQTVKFPEFHRYTPIRVVKLVLIPKFKVY*ATQKFAPNLLTPTKTESVLIFVR 220 R + ++ + F RY P+R ++L++ ++ TQ P + +++F R Sbjct: 152 RYNPVRYAQLMVFTRYNPVRYLQLLVFTRYNPVRYTQLMVFTRYNPVRYTQLIVFTR 208 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +2 Query: 86 FHRYTPIRVVKLVLIPKFKVY*ATQKFAPNLLTPTKTESVLIFVR 220 F RY P+R +L++ ++ TQ P + +++F R Sbjct: 206 FTRYNPVRYTQLIVFTRYNPVRYTQLIVFTRYNPVRYAQLMVFTR 250 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/57 (21%), Positives = 27/57 (47%) Frame = +2 Query: 50 RGSSIQTVKFPEFHRYTPIRVVKLVLIPKFKVY*ATQKFAPNLLTPTKTESVLIFVR 220 R + ++ ++ F RY P+R +L++ ++ TQ P + +++F R Sbjct: 166 RYNPVRYLQLLVFTRYNPVRYTQLMVFTRYNPVRYTQLIVFTRYNPVRYTQLIVFTR 222 >SB_4707| Best HMM Match : Toxin_17 (HMM E-Value=8.2) Length = 121 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 375 HDGHTAKVLCFHVTSFVSGRVRIFVRN 295 HDG + +CFH S +R+ V+N Sbjct: 72 HDGIVPRTICFHKLSCCDDPIRVVVKN 98 >SB_39949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 243 KTFARIVDLTKMRTLSVLVGVNKFGANFWVA 151 K FAR++ T +R + VL+ + FG + W A Sbjct: 17 KQFARLLIKTPVRIVVVLLSLGLFGVSIWEA 47 >SB_43930| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 915 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 37 TTGRTWKLDSDSEISGVPPIHADKGGEAGPYT-KVQGLLSYPEI 165 T G+TW E G+P + A GG A P + + +LS +I Sbjct: 119 TAGKTWNASCFCEGRGMPLVGAVIGGAASPISLNIANVLSVNDI 162 >SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2250 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = +1 Query: 283 GGFWVSYEDPDTAGNKASYVKTKNLGGVSIMDLSMDDFRGLCTGDKYPILRAAK 444 GG WV + GN+ + T + G V I S + G Y I+R K Sbjct: 1217 GGSWVDVDQDAYCGNRTRFNVTSSCGWVRIRFKSDESITGRGFNATYRIIRDRK 1270 >SB_56079| Best HMM Match : RnaseH (HMM E-Value=8.1) Length = 264 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 462 KSLKSVFCGPQDRIFISSAKTTKIIHGKVHDGH 364 KS KSV G + +IF + +I+H H H Sbjct: 24 KSFKSVVAGNKVKIFSDNQNVVRIVHNGSHVPH 56 >SB_74| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +1 Query: 271 DHGEGGFWVSYEDPDTAGNKASYV--KTKNLGG 363 D+G+G + VSYE P+ GN V + +N+GG Sbjct: 382 DNGDGTYTVSYE-PNQRGNHKIIVTIRNRNIGG 413 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,733,603 Number of Sequences: 59808 Number of extensions: 401315 Number of successful extensions: 991 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -