BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E08 (515 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein si... 32 0.20 At3g16460.2 68416.m02097 jacalin lectin family protein contains ... 31 0.61 At3g16460.1 68416.m02098 jacalin lectin family protein contains ... 31 0.61 At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family pr... 30 0.80 At4g34350.1 68417.m04881 LytB family protein contains Pfam profi... 28 3.2 At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein si... 28 3.2 At4g20190.1 68417.m02952 hypothetical protein 27 5.7 At3g11670.2 68416.m01431 digalactosyldiacylglycerol synthase 1 (... 27 5.7 At3g11670.1 68416.m01430 digalactosyldiacylglycerol synthase 1 (... 27 5.7 At2g46530.2 68415.m05803 transcriptional factor B3 family protei... 27 5.7 At2g46530.1 68415.m05802 transcriptional factor B3 family protei... 27 5.7 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 27 7.5 At5g57000.1 68418.m07114 expressed protein similar to unknown pr... 27 7.5 At4g25390.2 68417.m03653 protein kinase family protein contains ... 27 7.5 At4g25390.1 68417.m03652 protein kinase family protein contains ... 27 7.5 At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein si... 27 7.5 At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein si... 27 7.5 At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containi... 27 7.5 At5g24120.1 68418.m02835 RNA polymerase sigma subunit SigE (sigE... 27 9.9 At4g27690.1 68417.m03981 vacuolar protein sorting-associated pro... 27 9.9 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 27 9.9 At3g07300.1 68416.m00869 eukaryotic translation initiation facto... 27 9.9 At1g07650.1 68414.m00821 leucine-rich repeat transmembrane prote... 27 9.9 >At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 398 Score = 32.3 bits (70), Expect = 0.20 Identities = 36/142 (25%), Positives = 53/142 (37%) Frame = +1 Query: 1 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKLI 180 G P K VLG G W L +D +++G GP G +SY ++ ++ Sbjct: 224 GLPAKKAVLGFPYYGWAWTL-ADPDVNGYD------ANTTGPAISDDGEISYRQLQTWIV 276 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKASYVKTKNLG 360 + NG KV+D G Y + G W+ Y+ + K Y K K L Sbjct: 277 D---NGAT----KVHD-DMMVGDYCYA-------GTTWIGYDSEKSIVTKVIYAKQKGLL 321 Query: 361 GVSIMDLSMDDFRGLCTGDKYP 426 G + DD L + P Sbjct: 322 GYFSWHVGGDDNSELSSAGSTP 343 >At3g16460.2 68416.m02097 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 647 Score = 30.7 bits (66), Expect = 0.61 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 1 GAPTHKL-VLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKL 177 G+ KL G ST G +W D S+ GV I+A GGE Y K + L Sbjct: 249 GSGAQKLEAQGNSTGGTSW--DDGSDYDGVTKIYASYGGEGIQYVKFDYVKGGVTKQGVL 306 Query: 178 INPNQNGKRPHLRKVNDPSK 237 Q+ + P +N P + Sbjct: 307 HGKQQSRQNPREFVINHPDE 326 >At3g16460.1 68416.m02098 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 705 Score = 30.7 bits (66), Expect = 0.61 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 1 GAPTHKL-VLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKL 177 G+ KL G ST G +W D S+ GV I+A GGE Y K + L Sbjct: 249 GSGAQKLEAQGNSTGGTSW--DDGSDYDGVTKIYASYGGEGIQYVKFDYVKGGVTKQGVL 306 Query: 178 INPNQNGKRPHLRKVNDPSK 237 Q+ + P +N P + Sbjct: 307 HGKQQSRQNPREFVINHPDE 326 >At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family protein bHLH protein, Arabidopsis thaliana, PATCHX:E255557 Length = 589 Score = 30.3 bits (65), Expect = 0.80 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Frame = +1 Query: 223 NDPSKRFGTYAFRLPDDHGEG--GFWVSYEDPDTAGNKASYVKTKNLGGVSIMDLSMDDF 396 N+ FG++AF L D GE G W+S + +G A+ V N G S + Sbjct: 253 NNGGGEFGSWAFNLNPDQGENDPGLWISEPNGVDSGLVAAPV-MNNGGNDSTSNSDSQPI 311 Query: 397 RGLCTG 414 LC G Sbjct: 312 SKLCNG 317 >At4g34350.1 68417.m04881 LytB family protein contains Pfam profile: PF02401 LytB protein Length = 466 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +1 Query: 19 LVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAK 174 LV+G + T L SE G+P D GP K+ L Y E+ K Sbjct: 372 LVVGGWNSSNTSHLQEISEARGIPSYWIDSEKRIGPGNKIAYKLHYGELVEK 423 >At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 379 Score = 28.3 bits (60), Expect = 3.2 Identities = 34/135 (25%), Positives = 48/135 (35%) Frame = +1 Query: 1 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKLI 180 G P K VLG G W+L + + S P G P G + Y +I ++ Sbjct: 246 GLPAKKAVLGFPYYGYAWRLTNANSHSYYAPT---TGAAISP----DGSIGYGQIRKFIV 298 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKASYVKTKNLG 360 + NG S G Y + G W+ Y+D + K Y K + L Sbjct: 299 D---NGATTVYN-----STVVGDYCYA-------GTNWIGYDDNQSIVTKVRYAKQRGLL 343 Query: 361 GVSIMDLSMDDFRGL 405 G + DD GL Sbjct: 344 GYFSWHVGADDNSGL 358 >At4g20190.1 68417.m02952 hypothetical protein Length = 389 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/88 (21%), Positives = 34/88 (38%) Frame = -3 Query: 414 SSAKTTKIIHGKVHDGHTAKVLCFHVTSFVSGRVRIFVRNPEATFTMIIRKAEGIGPKTF 235 S+ +K I+ DG LC ++ F G+ R +++FT R ++ Sbjct: 195 SNTANSKSINS-FEDGFKCSALCLYLPGFSKGKPVRSSRKGDSSFT---RTTTMTSSQSM 250 Query: 234 ARIVDLTKMRTLSVLVGVNKFGANFWVA 151 AR + LS + +F W + Sbjct: 251 ARTASIRDTAVLSARASLERFECGSWTS 278 >At3g11670.2 68416.m01431 digalactosyldiacylglycerol synthase 1 (DGD1) / MGDG:MGDG galactosyltransferase / galactolipid galactosyltransferase identical to digalactosyldiacylglycerol synthase (DGD1) GI:5354158 [Arabidopsis thaliana] Length = 639 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 274 HGEGGFWVSYEDPDTAGNK 330 H +GGFW + P+T NK Sbjct: 325 HYDGGFWTDFVKPETPENK 343 >At3g11670.1 68416.m01430 digalactosyldiacylglycerol synthase 1 (DGD1) / MGDG:MGDG galactosyltransferase / galactolipid galactosyltransferase identical to digalactosyldiacylglycerol synthase (DGD1) GI:5354158 [Arabidopsis thaliana] Length = 808 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 274 HGEGGFWVSYEDPDTAGNK 330 H +GGFW + P+T NK Sbjct: 325 HYDGGFWTDFVKPETPENK 343 >At2g46530.2 68415.m05803 transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related contains Pfam profiles: PF02309 AUX/IAA family, PF02362 B3 DNA binding domain Length = 514 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 158 QKFAPNLLTPTKTESVLIFVRSTILANVLG-PMPSAFL 268 + F+P+ LTPT T+ RS ++ + G P+ S+FL Sbjct: 263 EPFSPSALTPTPTQQQSKSKRSRPISEITGSPVASSFL 300 >At2g46530.1 68415.m05802 transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related contains Pfam profiles: PF02309 AUX/IAA family, PF02362 B3 DNA binding domain Length = 601 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 158 QKFAPNLLTPTKTESVLIFVRSTILANVLG-PMPSAFL 268 + F+P+ LTPT T+ RS ++ + G P+ S+FL Sbjct: 350 EPFSPSALTPTPTQQQSKSKRSRPISEITGSPVASSFL 387 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYA 255 NPN N +R + K D S FG+YA Sbjct: 44 NPNPNFERSNSSKQCDDSSEFGSYA 68 >At5g57000.1 68418.m07114 expressed protein similar to unknown protein (gb|AAF21159.1) Length = 187 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 307 LRKKPRSHLHHDHQE 263 L++KP HLHH H+E Sbjct: 87 LKEKPPRHLHHHHKE 101 >At4g25390.2 68417.m03653 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 497 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/62 (27%), Positives = 30/62 (48%) Frame = +1 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKASYVKTKNLG 360 N + + +RP R+ + S R T +F + G+GGF V + + G + VK + G Sbjct: 74 NASSSPRRPSPREFSYSSLRRATGSFSQANRLGQGGFGVVFRGTISGGENVA-VKVMDSG 132 Query: 361 GV 366 + Sbjct: 133 SL 134 >At4g25390.1 68417.m03652 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 651 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/62 (27%), Positives = 30/62 (48%) Frame = +1 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKASYVKTKNLG 360 N + + +RP R+ + S R T +F + G+GGF V + + G + VK + G Sbjct: 74 NASSSPRRPSPREFSYSSLRRATGSFSQANRLGQGGFGVVFRGTISGGENVA-VKVMDSG 132 Query: 361 GV 366 + Sbjct: 133 SL 134 >At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 261 Score = 27.1 bits (57), Expect = 7.5 Identities = 33/142 (23%), Positives = 48/142 (33%) Frame = +1 Query: 1 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKLI 180 G P K VLG G W L P H GP G +SY ++ ++ Sbjct: 137 GLPAEKAVLGFPYYGWAWTLAD-------PKNHGYYVDTTGPAISDDGEISYSQLKTWIV 189 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNKASYVKTKNLG 360 + V+D + G Y + G W+ Y+ ++ K Y K K L Sbjct: 190 DNKAT-------TVHD-NIVIGDYCYA-------GTTWIGYDSEESIVTKVIYAKQKGLL 234 Query: 361 GVSIMDLSMDDFRGLCTGDKYP 426 G + DD L + P Sbjct: 235 GYFSWQVGGDDKSELSSAGSSP 256 >At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 332 Score = 27.1 bits (57), Expect = 7.5 Identities = 30/110 (27%), Positives = 42/110 (38%) Frame = +1 Query: 1 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKLI 180 G P K VLG S G W L +D + +G A ++ G ++Y +I Sbjct: 239 GLPEKKAVLGFSYVGWAWTLQNDKD-TGYNAAAAGVAKSEDDVSE-DGSINYAQI----- 291 Query: 181 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDHGEGGFWVSYEDPDTAGNK 330 N+ + KV DP K G Y F W+ YED + K Sbjct: 292 --NKFIRDEEAAKVYDP-KVVGHYCFAKK-------IWIGYEDTQSVEAK 331 >At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 501 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 258 EGIGPKTFARIVDLTKMRTLSVLVGVNKFG-ANFW 157 EGIG K R+++L R+ ++++ N+F A W Sbjct: 401 EGIGEKVKKRLIELEPKRSGNLVIVANRFAEARMW 435 >At5g24120.1 68418.m02835 RNA polymerase sigma subunit SigE (sigE) / sigma-like factor (SIG5) identical to RNA polymerase sigma subunit SigE [Arabidopsis thaliana] GI:4972299, sigma-like factor [Arabidopsis thaliana] GI:4033838; contains Pfam profiles PF04545: Sigma-70, region 4, PF04539: Sigma-70 region 3, PF04542: Sigma-70 region 2 Length = 517 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 361 GVSIMDLSMDDFRGLCTG-DKYPILRAAKYRL*TFSLYF*KHAL 489 G DL RGL T D++ R K+RL T+ L++ +HA+ Sbjct: 305 GPKFQDLCQAGMRGLITAIDRFEPKR--KFRLSTYGLFWIRHAI 346 >At4g27690.1 68417.m03981 vacuolar protein sorting-associated protein 26, putative / VPS26, putative similar to vacuolar sorting protein 26 [Homo sapiens] GI:9622852; contains Pfam profile PF03643: Vacuolar protein sorting-associated protein 26 Length = 303 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 Query: 423 IFISSAKTTKIIHGKVHDGHTAKVLCFHVTSFVSGRVRI 307 I S K K + K +G TA V FH +SG+V I Sbjct: 16 ITFSDGKNRKQVPMKKENGQTALVPLFHSQDTISGKVCI 54 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 322 RPCQDLRKKPRSHLHH-DHQEGGRHRSQNVC*DR 224 +P + R +PR HH D +GGR R ++ DR Sbjct: 285 QPRERSRDRPREDKHHRDRDQGGRDRDRDSRRDR 318 >At3g07300.1 68416.m00869 eukaryotic translation initiation factor 2B family protein / eIF-2B family protein similar to SP|P49770 Translation initiation factor eIF-2B beta subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF01008: Initiation factor 2 subunit family Length = 407 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 346 TKNLGGVSIMDLSMDDFRGLCTGDKYPILRAA 441 T +GG+ ++D S DD C G +P + AA Sbjct: 93 TAAMGGLDLLDASDDDDVDNCKGIGFPAMSAA 124 >At1g07650.1 68414.m00821 leucine-rich repeat transmembrane protein kinase, putative similar to GB:AAC50043 from [Arabidopsis thaliana] (Plant Mol. Biol. 37 (4), 587-596 (1998)) Length = 1014 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = -3 Query: 303 VRNPEATFTMIIRKAEGIGPKTFARIVDLTKMRTLSV 193 ++N E+ T+I+RK + IGP I DL K++TL + Sbjct: 277 LKNLESIKTLILRKCKIIGPIP-KYIGDLKKLKTLDL 312 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,601,899 Number of Sequences: 28952 Number of extensions: 289909 Number of successful extensions: 780 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 779 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -