BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_E02 (629 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharom... 27 2.2 SPBC11G11.07 ||SPBC18H10.01|karyopherin|Schizosaccharomyces pomb... 25 6.8 >SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 27.1 bits (57), Expect = 2.2 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -1 Query: 158 PRYNLHCLKTCRSPHDYLHRRQLCTEALAS 69 P++N HCLK C L + C A S Sbjct: 711 PKFNRHCLKICERRLPLLQQSFFCLAATVS 740 >SPBC11G11.07 ||SPBC18H10.01|karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 955 Score = 25.4 bits (53), Expect = 6.8 Identities = 9/34 (26%), Positives = 21/34 (61%) Frame = +1 Query: 505 FPC*LYNHREEANHESATTVILYQKIKELEAQLV 606 F C L+N ++ + + ++LY ++ EL+ +L+ Sbjct: 242 FLCALFNETKDVDETTDAILMLYPRLLELQPKLI 275 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,688,300 Number of Sequences: 5004 Number of extensions: 57388 Number of successful extensions: 170 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -