BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D24 (542 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_22838| Best HMM Match : Arrestin_N (HMM E-Value=1.1e-30) 28 4.3 SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_14467| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_26631| Best HMM Match : ig (HMM E-Value=1.6e-22) 27 9.9 >SB_20559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 28.3 bits (60), Expect = 4.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 535 YGPKPFVRTLEVITCCLIVGRNCNI 461 + P F R L + CCL RNC++ Sbjct: 296 FSPNVFYRELPLPVCCLTYWRNCSV 320 >SB_22838| Best HMM Match : Arrestin_N (HMM E-Value=1.1e-30) Length = 173 Score = 28.3 bits (60), Expect = 4.3 Identities = 23/91 (25%), Positives = 36/91 (39%), Gaps = 1/91 (1%) Frame = +1 Query: 247 KAITYGIVKEEEQYVYYANYSNTFLYNNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSE 426 K +T+ IV + +Y+ + + E + Y E + F S + FH W Sbjct: 3 KGVTFEIVLNRKNRIYHPGE----VVSGE--CVVYSKESLKFRSVHVEFHGEARTNWDEM 56 Query: 427 RYGNLKHRRGEIYYNFYQQ-LNNTLLLRASL 516 H+ E+Y+N L N L RA L Sbjct: 57 ENYTTTHKNEEVYFNKKTSLLANVHLYRAVL 87 >SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1436 Score = 27.5 bits (58), Expect = 7.5 Identities = 19/72 (26%), Positives = 34/72 (47%) Frame = +1 Query: 250 AITYGIVKEEEQYVYYANYSNTFLYNNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSER 429 A+ + I ++ Y+YYA + YNN LTY+ N+ + + + L ++ Sbjct: 822 ALKWAITEKFRDYLYYAPSFTVYTYNNP---LTYILTTAKLNATGHRWVAEL-----ADY 873 Query: 430 YGNLKHRRGEIY 465 +K+R G IY Sbjct: 874 NFTIKYRPGRIY 885 >SB_14467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 27.5 bits (58), Expect = 7.5 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +1 Query: 355 TEDIGFNSYYYYFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQ-LNNTLLLRASL 516 TE + F S + FH W H+ E+Y+N L N L RA L Sbjct: 48 TESLKFRSVHVEFHGEARTNWDEIENYTTTHKNEEVYFNKKTSLLANVHLYRAVL 102 >SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3172 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 256 TYGIVKEEEQYVYYANYSNTFLYNNEEQRLTYLTEDIGFNSYYY 387 TYG V Q V ++ +N + N LT+ T D+G +S YY Sbjct: 125 TYGAVSMTTQEVCHSKKANLVVLN-----LTFRTSDLGGHSDYY 163 >SB_26631| Best HMM Match : ig (HMM E-Value=1.6e-22) Length = 1123 Score = 27.1 bits (57), Expect = 9.9 Identities = 13/59 (22%), Positives = 26/59 (44%) Frame = +1 Query: 268 VKEEEQYVYYANYSNTFLYNNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSERYGNLK 444 ++ +Q++ A + TF+Y+ E+ D + Y H L FW + N++ Sbjct: 644 IENLKQFIVQARFVETFVYDMTEKPGKCAIRDRERKTISYNDHRFLVFWTDFQNTNNMR 702 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,699,005 Number of Sequences: 59808 Number of extensions: 342301 Number of successful extensions: 858 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -