BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D23 (155 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 0.80 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 0.80 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 1.4 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 1.8 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 19 4.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 19 5.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 19 5.6 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 19 7.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 19 7.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 19 7.4 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 19 7.4 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 0.80 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 112 LFNNYFYTVS*PPVH*PGVYASFP 41 L+ NY + PV P Y +FP Sbjct: 116 LYKNYIINIEQIPVPVPVYYGNFP 139 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 0.80 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 112 LFNNYFYTVS*PPVH*PGVYASFP 41 L+ NY + PV P Y +FP Sbjct: 116 LYKNYIINIEQIPVPVPVYYGNFP 139 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 1.4 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = -2 Query: 142 FKSINIS*AVLFNNYFYTVS*PPVH*PGVYASFP 41 + + N + + + NY + PV P Y +FP Sbjct: 106 YNNNNYNKKLYYKNYIINIEQIPVPVPVYYGNFP 139 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 1.8 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 130 NIS*AVLFNNYFYTVS*PPVH*PGVYASFP 41 N + + + NY + PV P Y +FP Sbjct: 335 NYNKKLYYKNYIINIEQIPVPVPVYYGNFP 364 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 19.4 bits (38), Expect = 4.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 72 CTNLAFTPAFHCLPIVLFL 16 CT + T F CL +V L Sbjct: 222 CTQVYSTGNFTCLEVVFVL 240 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 19.0 bits (37), Expect = 5.6 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = -2 Query: 49 SFPLSSYCLIFM 14 S+ +S +CL+F+ Sbjct: 447 SYAVSGFCLLFL 458 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 19.0 bits (37), Expect = 5.6 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = -2 Query: 49 SFPLSSYCLIFM 14 S+ +S +CL+F+ Sbjct: 500 SYAVSGFCLLFL 511 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 18.6 bits (36), Expect = 7.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 25 DNRKTMESWRKRQVSAQGVKK 87 +N K SW + + SAQ K Sbjct: 39 NNIKRKRSWSRPRESAQTTSK 59 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 18.6 bits (36), Expect = 7.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 41 WKAGVNARLVHRGL 82 W+ +NARLV L Sbjct: 908 WQVTLNARLVELSL 921 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 18.6 bits (36), Expect = 7.4 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = +1 Query: 25 DNRKTMESWRKRQVSAQGVKKQYKSSY*KELPMRCLYF*INF 150 D R+ S + +S+ Y ++Y + LY+ IN+ Sbjct: 291 DRRERERSKEPKIISSLSNSCNYSNNYYNNNNYKKLYYNINY 332 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 18.6 bits (36), Expect = 7.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 74 RGLRNSIKVVIE 109 R L NS+KV+ E Sbjct: 23 RNLTNSLKVIYE 34 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,839 Number of Sequences: 438 Number of extensions: 516 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 31 effective length of database: 132,765 effective search space used: 2655300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.9 bits)
- SilkBase 1999-2023 -