BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D18 (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 1.5 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 4.6 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 4.6 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 21 8.1 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 8.1 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.4 bits (48), Expect = 1.5 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +2 Query: 80 ACSWAARPWQGVIGHNDILAKLSPIREKLKQLSEAGVKDKPEWFTKVLGL 229 A + A +P I H+D AKL+ IR+ Q E + E+ T V+ L Sbjct: 131 AAAQAGQP-DNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNL 179 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 4.6 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -2 Query: 586 LLFTINFVEYRMKVVLLC 533 ++FTI+ + Y + ++LLC Sbjct: 220 IIFTIHLLFYCVLIILLC 237 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.8 bits (44), Expect = 4.6 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -2 Query: 559 YRMKVVLLCHCGN-SYVIDCC*IRSVVLYTLETIILCRFL 443 Y + V H + YV+ +++VVLY LE IL + + Sbjct: 271 YIVMYVFFFHLSDVRYVMVVYLLKNVVLYGLELFILAKIV 310 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 21.0 bits (42), Expect = 8.1 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +2 Query: 155 REKLKQLSEAGVKDKPEWFTKV 220 +E ++++ VK KPEW+ ++ Sbjct: 78 KEGIRKVIHYLVKQKPEWWEQL 99 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 180 SDNCFSFSLIGDSLARISLCPMTPCQGLA 94 S++ SFSL D SL P +PC A Sbjct: 42 SEDMGSFSLPLDLEPLPSLFPFSPCNNTA 70 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,990 Number of Sequences: 336 Number of extensions: 2764 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -