BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D16 (670 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9U505 Cluster: ATP synthase lipid-binding protein, mit... 136 6e-31 UniRef50_P48201 Cluster: ATP synthase lipid-binding protein, mit... 81 2e-14 UniRef50_P05496 Cluster: ATP synthase lipid-binding protein, mit... 81 2e-14 UniRef50_UPI0000E25CD7 Cluster: PREDICTED: hypothetical protein ... 64 4e-09 UniRef50_P48880 Cluster: ATP synthase protein 9, mitochondrial; ... 55 1e-06 UniRef50_Q01554 Cluster: ATP synthase protein 9, mitochondrial; ... 50 5e-05 UniRef50_P60112 Cluster: ATP synthase protein 9, mitochondrial; ... 46 8e-04 UniRef50_Q4Q9E5 Cluster: ATPase subunit 9, putative; n=15; Trypa... 45 0.001 UniRef50_P00842 Cluster: ATP synthase protein 9, mitochondrial p... 44 0.003 UniRef50_A6RZ18 Cluster: Lipid-binding protein; n=2; Sclerotinia... 42 0.013 UniRef50_A3E3Y1 Cluster: Lipid-binding protein; n=1; Karlodinium... 40 0.072 UniRef50_UPI00015B585F Cluster: PREDICTED: similar to CG5912-PA;... 38 0.29 UniRef50_UPI0000D573BE Cluster: PREDICTED: similar to CG13320-PA... 38 0.29 UniRef50_Q7RI18 Cluster: ATPase subunit 9, putative; n=4; Plasmo... 38 0.29 UniRef50_Q4N435 Cluster: ATP synthase F0, subunit C, putative; n... 37 0.38 UniRef50_A7S1G4 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ... 37 0.51 UniRef50_Q37315 Cluster: ATP synthase protein 9, mitochondrial; ... 36 1.2 UniRef50_Q8IQ18 Cluster: CG33196-PB; n=10; Endopterygota|Rep: CG... 33 4.7 UniRef50_A2QU39 Cluster: Putative uncharacterized protein; n=1; ... 33 4.7 UniRef50_Q96E52 Cluster: Metalloendopeptidase OMA1, mitochondria... 33 4.7 UniRef50_UPI0000E7F9D1 Cluster: PREDICTED: similar to tripartite... 33 6.2 UniRef50_Q5FRW6 Cluster: ATP synthase C chain; n=4; Rhodospirill... 33 8.2 UniRef50_Q16E88 Cluster: Putative uncharacterized protein; n=2; ... 33 8.2 >UniRef50_Q9U505 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=143; Eukaryota|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 131 Score = 136 bits (328), Expect = 6e-31 Identities = 71/98 (72%), Positives = 74/98 (75%) Frame = +1 Query: 103 FSNTALVRPLAAVPTHTQIVPVAPAQLSAVRTFQTTSVTKDIDSAAKFXXXXXXXXXXXX 282 FSN A+VRPLAAV T TQ+VP APAQLSAVR+FQTTSVTKDIDSAAKF Sbjct: 17 FSNAAVVRPLAAVSTQTQLVPAAPAQLSAVRSFQTTSVTKDIDSAAKFIGAGAATVGVAG 76 Query: 283 XXXXXXXXFGSLIIGYARNPSLKQQLFSYAILGFALSE 396 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 77 SGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE 114 >UniRef50_P48201 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=111; cellular organisms|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Homo sapiens (Human) Length = 142 Score = 81.4 bits (192), Expect = 2e-14 Identities = 41/68 (60%), Positives = 47/68 (69%) Frame = +1 Query: 193 RTFQTTSVTKDIDSAAKFXXXXXXXXXXXXXXXXXXXXFGSLIIGYARNPSLKQQLFSYA 372 R FQT+++++DID+AAKF FGSLIIGYARNPSLKQQLFSYA Sbjct: 58 REFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYA 117 Query: 373 ILGFALSE 396 ILGFALSE Sbjct: 118 ILGFALSE 125 >UniRef50_P05496 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=16; Eutheria|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Homo sapiens (Human) Length = 136 Score = 81.4 bits (192), Expect = 2e-14 Identities = 45/75 (60%), Positives = 50/75 (66%) Frame = +1 Query: 172 PAQLSAVRTFQTTSVTKDIDSAAKFXXXXXXXXXXXXXXXXXXXXFGSLIIGYARNPSLK 351 P Q+ A R FQT+ V++DID+AAKF FGSLIIGYARNPSLK Sbjct: 46 PLQV-ARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLK 104 Query: 352 QQLFSYAILGFALSE 396 QQLFSYAILGFALSE Sbjct: 105 QQLFSYAILGFALSE 119 >UniRef50_UPI0000E25CD7 Cluster: PREDICTED: hypothetical protein isoform 2; n=1; Pan troglodytes|Rep: PREDICTED: hypothetical protein isoform 2 - Pan troglodytes Length = 80 Score = 63.7 bits (148), Expect = 4e-09 Identities = 28/72 (38%), Positives = 44/72 (61%) Frame = -2 Query: 438 QQKERHHKTEETHSLRQGETQDGI*EQLLFKGGVPGITNDEGTEYRSNTRSGSSYSNCRC 259 + ++ HH+ + H L +G+ Q G+ E+LL + VPGITNDE ++ N +S+ NC Sbjct: 8 EDEKGHHQAKAPHGLSEGKAQSGVGEELLLQRRVPGITNDEAPKHSPNLSRRASHPNCGS 67 Query: 258 ASTNEFGSRVNV 223 S+NE G V+V Sbjct: 68 PSSNELGCCVDV 79 >UniRef50_P48880 Cluster: ATP synthase protein 9, mitochondrial; n=4; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Chondrus crispus (Carragheen) Length = 76 Score = 55.2 bits (127), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 FGSL++ YARNPSLKQQLF Y ILGFAL+E Sbjct: 31 FGSLVMAYARNPSLKQQLFGYTILGFALTE 60 >UniRef50_Q01554 Cluster: ATP synthase protein 9, mitochondrial; n=22; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Trichophyton rubrum Length = 74 Score = 50.0 bits (114), Expect = 5e-05 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 FG+LI+G ARNPSL+ LFSYAILGFA SE Sbjct: 28 FGALILGVARNPSLRGLLFSYAILGFAFSE 57 >UniRef50_P60112 Cluster: ATP synthase protein 9, mitochondrial; n=72; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Arabidopsis thaliana (Mouse-ear cress) Length = 85 Score = 46.0 bits (104), Expect = 8e-04 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 F SLI ARNPSL +QLF YAILGFAL+E Sbjct: 39 FSSLIHSVARNPSLAKQLFGYAILGFALTE 68 >UniRef50_Q4Q9E5 Cluster: ATPase subunit 9, putative; n=15; Trypanosomatidae|Rep: ATPase subunit 9, putative - Leishmania major Length = 252 Score = 45.2 bits (102), Expect = 0.001 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 FG L+IG AR P+L + LF+YAILGFAL+E Sbjct: 207 FGCLLIGCARQPNLTKMLFNYAILGFALTE 236 >UniRef50_P00842 Cluster: ATP synthase protein 9, mitochondrial precursor; n=14; Pezizomycotina|Rep: ATP synthase protein 9, mitochondrial precursor - Neurospora crassa Length = 147 Score = 44.0 bits (99), Expect = 0.003 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 F +L+ G ARNP+L+ QLFSYAILGFA E Sbjct: 102 FAALLNGVARNPALRGQLFSYAILGFAFVE 131 >UniRef50_A6RZ18 Cluster: Lipid-binding protein; n=2; Sclerotiniaceae|Rep: Lipid-binding protein - Botryotinia fuckeliana B05.10 Length = 149 Score = 41.9 bits (94), Expect = 0.013 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 F +L+ ARNPS++ QLFSYAILGFA E Sbjct: 104 FAALLQAVARNPSMRGQLFSYAILGFAFVE 133 >UniRef50_A3E3Y1 Cluster: Lipid-binding protein; n=1; Karlodinium micrum|Rep: Lipid-binding protein - Karlodinium micrum (Dinoflagellate) Length = 130 Score = 39.5 bits (88), Expect = 0.072 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 F +L++G ARNPS+K+ LF+Y ++G E Sbjct: 84 FAALVVGMARNPSMKEDLFTYTLIGMGFLE 113 >UniRef50_UPI00015B585F Cluster: PREDICTED: similar to CG5912-PA; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to CG5912-PA - Nasonia vitripennis Length = 1634 Score = 37.5 bits (83), Expect = 0.29 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = -2 Query: 147 CRHCCEWSHKSC----VAEDSSPGCRGDQSCGIQHFCVLRGATTDNKE 16 C H C S SC V D CR SCG +HF L +TD+K+ Sbjct: 1238 CSHICLGSRCSCPQSLVLADDGKNCRVAPSCGPEHFTCLTSKSTDSKD 1285 >UniRef50_UPI0000D573BE Cluster: PREDICTED: similar to CG13320-PA, isoform A; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG13320-PA, isoform A - Tribolium castaneum Length = 378 Score = 37.5 bits (83), Expect = 0.29 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +1 Query: 181 LSAVRTFQTTSVTKDIDSAAKF 246 L AVR+FQTT V++DIDSAAKF Sbjct: 32 LPAVRSFQTTPVSRDIDSAAKF 53 >UniRef50_Q7RI18 Cluster: ATPase subunit 9, putative; n=4; Plasmodium|Rep: ATPase subunit 9, putative - Plasmodium yoelii yoelii Length = 189 Score = 37.5 bits (83), Expect = 0.29 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 F +L++G +RNPS+K +LF+Y ++G E Sbjct: 120 FSALVLGTSRNPSIKDELFTYTLIGMGFLE 149 >UniRef50_Q4N435 Cluster: ATP synthase F0, subunit C, putative; n=3; Piroplasmida|Rep: ATP synthase F0, subunit C, putative - Theileria parva Length = 163 Score = 37.1 bits (82), Expect = 0.38 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 F +L+ G ARNPS+K+ LF+Y ++G E Sbjct: 118 FAALVSGTARNPSIKEDLFTYTLIGMGFLE 147 >UniRef50_A7S1G4 Cluster: Predicted protein; n=3; Eumetazoa|Rep: Predicted protein - Nematostella vectensis Length = 276 Score = 36.7 bits (81), Expect = 0.51 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 171 CNWNNLCVCRHCCEWSHKSCVAEDSSPGCRGDQSCGIQHFC 49 C NN C HCC H C D GC GD C H C Sbjct: 46 CTRNNYCTRDHCCTRDH--CCIRDR--GCTGDHCCTRDHCC 82 >UniRef50_Q37315 Cluster: ATP synthase protein 9, mitochondrial; n=11; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Dictyostelium discoideum (Slime mold) Length = 88 Score = 35.5 bits (78), Expect = 1.2 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 F + I+ NP+L+ +LF A+LGFALSE Sbjct: 43 FAAFILAVGMNPNLRGELFKLAMLGFALSE 72 >UniRef50_Q8IQ18 Cluster: CG33196-PB; n=10; Endopterygota|Rep: CG33196-PB - Drosophila melanogaster (Fruit fly) Length = 23015 Score = 33.5 bits (73), Expect = 4.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 150 VCRHCCEWSH-KSCVAEDSSPGCRGDQSCGIQHFCV 46 +CRH E H + C+ + PGCR DQ C + CV Sbjct: 3115 LCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCV 3150 >UniRef50_A2QU39 Cluster: Putative uncharacterized protein; n=1; Aspergillus niger|Rep: Putative uncharacterized protein - Aspergillus niger Length = 197 Score = 33.5 bits (73), Expect = 4.7 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -2 Query: 315 GTEYRSNTRSGSSYSNCRCASTNEFGSRVNVFGDRG 208 GTEY ++T +GS+ +CR + S V +FG RG Sbjct: 2 GTEYTTSTTAGSTPVSCRSTVSGLINSVVRLFGPRG 37 >UniRef50_Q96E52 Cluster: Metalloendopeptidase OMA1, mitochondrial precursor; n=9; Theria|Rep: Metalloendopeptidase OMA1, mitochondrial precursor - Homo sapiens (Human) Length = 524 Score = 33.5 bits (73), Expect = 4.7 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +1 Query: 103 FSNTALVRPLAAVPTHTQIVPVAPAQLSAVRTFQTT 210 FS L++ + AVP+ + + P++PA + A+R F T+ Sbjct: 104 FSRQLLIKEVTAVPSLSVLHPLSPASIRAIRNFHTS 139 >UniRef50_UPI0000E7F9D1 Cluster: PREDICTED: similar to tripartite motif-containing 45 isoform 1; n=4; Gallus gallus|Rep: PREDICTED: similar to tripartite motif-containing 45 isoform 1 - Gallus gallus Length = 531 Score = 33.1 bits (72), Expect = 6.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 33 SHPSKHKNVVCRKIDRPCSQDCYLQQH 113 SHPS+ + C + D+P QDC ++H Sbjct: 143 SHPSEELGLFCEQCDQPVCQDCVAERH 169 >UniRef50_Q5FRW6 Cluster: ATP synthase C chain; n=4; Rhodospirillales|Rep: ATP synthase C chain - Gluconobacter oxydans (Gluconobacter suboxydans) Length = 85 Score = 32.7 bits (71), Expect = 8.2 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 307 FGSLIIGYARNPSLKQQLFSYAILGFALSE 396 F +LI ARNP+ + +F +LGFAL+E Sbjct: 40 FSTLISSVARNPASRPHVFGIGMLGFALTE 69 >UniRef50_Q16E88 Cluster: Putative uncharacterized protein; n=2; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 945 Score = 32.7 bits (71), Expect = 8.2 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = -2 Query: 459 IDSLESEQQKERHHKTEETHSLRQGETQDGI*EQLLF-KGGVPGI-TNDEGTEYR 301 + L QQ+++HH +E H +Q + QD +Q+L + G P I ++GT Y+ Sbjct: 752 LKKLPMHQQQQQHHHQQEQHDAQQQQEQDTQVQQILTNEDGSPIIVAGEDGTLYQ 806 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 644,177,724 Number of Sequences: 1657284 Number of extensions: 12420291 Number of successful extensions: 33899 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 32302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33869 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51239674196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -