BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D15 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53765| Best HMM Match : 3HCDH_N (HMM E-Value=9.2e-12) 134 8e-32 SB_21667| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_8863| Best HMM Match : DAO (HMM E-Value=0.04) 32 0.35 SB_22397| Best HMM Match : DAO (HMM E-Value=7.6e-06) 31 1.1 SB_15161| Best HMM Match : MAP1B_neuraxin (HMM E-Value=2.7) 31 1.1 SB_57609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57099| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_58552| Best HMM Match : UbiD (HMM E-Value=1.1) 28 7.6 SB_17988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 7.6 >SB_53765| Best HMM Match : 3HCDH_N (HMM E-Value=9.2e-12) Length = 120 Score = 134 bits (323), Expect = 8e-32 Identities = 57/117 (48%), Positives = 81/117 (69%), Gaps = 1/117 (0%) Frame = +2 Query: 308 ECVPENLELKKKVFQNLDNVVDDN-TIXXXXXXXXXXXXXXENMKHKAQVIVSHPVNPPY 484 EC PENLELKKKVFQNL+ + + I E+++ + + IV+HP+NPPY Sbjct: 1 ECTPENLELKKKVFQNLEATLSSSEVILASSTSCIMPSKFTESLQLRQRCIVAHPINPPY 60 Query: 485 YVPLVEIVPAPWTKPEVTKKTRAIMEEIGQEPVTLSREIDGFVLNRIQYAILGEVWR 655 YVPLVE++PAPWT V ++T +M++IGQ PV L +E +GF++NR+QYA++ E WR Sbjct: 61 YVPLVEVIPAPWTDASVIEQTIKLMKDIGQSPVLLKKETNGFIVNRLQYALIAEAWR 117 >SB_21667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 812 Score = 58.0 bits (134), Expect = 6e-09 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 1/170 (0%) Frame = +2 Query: 56 VGIVGSGLIGRSWAMLFASVGYQVTLFDVVEKQITDAIADIKVQLKTLEKDGLLRGNLNA 235 V ++G+GL+G A A G +V L+D Q + ++ +Q +K+ L R + A Sbjct: 8 VAVIGAGLMGTCIAGELAYHGARVNLYDR-SAQAMEKSKEMLIQ----QKEQLKREEVMA 62 Query: 236 DEQFQCVKGTCD-LAIAVKDAIFVQECVPENLELKKKVFQNLDNVVDDNTIXXXXXXXXX 412 F C+ L AV ++ + E ENLE+KK VF+++ N + Sbjct: 63 TSDFIGTVAFCESLEEAVVNSGLIFEATIENLEVKKSVFKSISQFCRTNAVIATNTLALD 122 Query: 413 XXXXXENMKHKAQVIVSHPVNPPYYVPLVEIVPAPWTKPEVTKKTRAIME 562 E++ + + + + P Y +P VEI T PE +K + +E Sbjct: 123 TSVVAEHVTNPERCLGIRFLYPVYSIPEVEITLGSQTSPETIQKVQQFLE 172 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +2 Query: 212 LLRGNLNADEQFQ--CVKGTCDLAIAVKDAIFVQECVPENL 328 LLR + DE + C++ CD+A+ V D F+ +CV ++L Sbjct: 806 LLRDTNDTDECMKECCLRDECDVAVMVSDYCFMADCVSDSL 846 >SB_8863| Best HMM Match : DAO (HMM E-Value=0.04) Length = 485 Score = 32.3 bits (70), Expect = 0.35 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 53 KVGIVGSGLIGRSWAMLFASVGYQVTLFD 139 +V IVG GL+G A+ FA GY+V L++ Sbjct: 165 EVAIVGGGLVGALSAVFFAKRGYKVDLYE 193 >SB_22397| Best HMM Match : DAO (HMM E-Value=7.6e-06) Length = 456 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = +2 Query: 29 MASKFKSEKVGIVGSGLIGRSWAMLFASVGYQVTL 133 ++S F ++V ++G+G+IG + A + GY+VT+ Sbjct: 13 LSSPFGGQRVLVIGAGVIGLTTAYELLTAGYEVTV 47 >SB_15161| Best HMM Match : MAP1B_neuraxin (HMM E-Value=2.7) Length = 210 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 141 TSNKVTWYPTEANNIAHDLPISPLPTIPTFSDLNL 37 TS K +WYP N D+P+S LP+I S + L Sbjct: 55 TSEKNSWYPNPEN----DIPLSTLPSIQPLSKVKL 85 >SB_57609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 53 KVGIVGSGLIGRSWAMLFASVGYQVTLFDVVE 148 KVGIVGSG+ G S A L G +V L++ E Sbjct: 2 KVGIVGSGIAGLSAAWLLTLRGNEVHLYEKQE 33 >SB_57099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2509 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 515 PWTKPEVTKKTRAIMEEIGQEPVTLSREID 604 PW + R + + IG++P TL REID Sbjct: 1831 PWLSSAEERLARKMAQPIGRDPSTLRREID 1860 >SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +2 Query: 44 KSEKVGIVGSGLIGRSWAMLFASVGYQVTLFDVVEK 151 KS KV IVGSG+ G A S G VT+ + E+ Sbjct: 249 KSPKVIIVGSGIAGLMAARQLQSFGIDVTMVEARER 284 >SB_58552| Best HMM Match : UbiD (HMM E-Value=1.1) Length = 409 Score = 27.9 bits (59), Expect = 7.6 Identities = 26/106 (24%), Positives = 51/106 (48%) Frame = +2 Query: 56 VGIVGSGLIGRSWAMLFASVGYQVTLFDVVEKQITDAIADIKVQLKTLEKDGLLRGNLNA 235 VG+VG+G++ R A + L + + I++ ++ K L+ DG + + Sbjct: 288 VGVVGAGVVSRGLTGKVAKHEDTMVLAESKKNSISELVS------KALQ-DGRI-----S 335 Query: 236 DEQFQCVKGTCDLAIAVKDAIFVQECVPENLELKKKVFQNLDNVVD 373 DE+F+ + + +KDAI + + + +L V +L N+VD Sbjct: 336 DEEFRLILQEQERYNTLKDAIRARHGLAPHYDLPNIVDYDLPNIVD 381 >SB_17988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 254 VKGTCDLAIAVKDAIFVQECVPENLELKKKVFQNLD 361 +K + D+ +V DA V E + ENL K K+F LD Sbjct: 13 LKISLDVPGSVADADLVIEAIVENLRTKHKLFTALD 48 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = +2 Query: 428 ENMKHKAQVIVSHPVNP------PYYVPLVEIVPAPWTKPEVTKKTRAIMEEIGQEPVTL 589 E+ K K V+ P P P Y+P+ P P P+ K ++++++I Q +TL Sbjct: 101 EDAKRKFLVLAPFPRMPLISPPLPMYIPVPVPQPVPQPVPQPASKGKSVLDKILQLQMTL 160 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,408,389 Number of Sequences: 59808 Number of extensions: 422861 Number of successful extensions: 2670 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2668 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -