SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0001_D13
         (587 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF387862-2|AAL56548.1|  942|Anopheles gambiae pol polyprotein pr...    26   1.0  
AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s...    24   4.2  
Y13592-1|CAA73920.1|  136|Anopheles gambiae voltage-gated sodium...    23   7.3  
AY615653-1|AAU05110.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615652-1|AAU05109.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615651-1|AAU05108.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615650-1|AAU05107.1|   62|Anopheles gambiae sodium channel pro...    23   7.3  
AY615649-1|AAU05106.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615648-1|AAU05105.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615647-1|AAU05104.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615646-1|AAU05103.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615645-1|AAU05102.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615644-1|AAU05101.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615643-1|AAU05100.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615642-1|AAU05099.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615641-1|AAU05098.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615640-1|AAU05097.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615639-1|AAU05096.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615638-1|AAU05095.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615637-1|AAU05094.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615636-1|AAU05093.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615635-1|AAU05092.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615634-1|AAU05091.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615633-1|AAU05090.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615632-1|AAU05089.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615631-1|AAU05088.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615630-1|AAU05087.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615629-1|AAU05086.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615628-1|AAU05085.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615627-1|AAU05084.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615626-1|AAU05083.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615625-1|AAU05082.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615624-1|AAU05081.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615623-1|AAU05080.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615622-1|AAU05079.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615621-1|AAU05078.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615620-1|AAU05077.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615619-1|AAU05076.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615618-1|AAU05075.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615617-1|AAU05074.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615616-1|AAU05073.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615615-1|AAU05072.1|   69|Anopheles gambiae sodium channel pro...    23   7.3  
AY615614-1|AAU05071.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615613-1|AAU05070.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615612-1|AAU05069.1|   69|Anopheles gambiae sodium channel pro...    23   7.3  
AY615611-1|AAU05068.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615610-1|AAU05067.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615609-1|AAU05066.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615608-1|AAU05065.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615607-1|AAU05064.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615606-1|AAU05063.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615605-1|AAU05062.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615604-1|AAU05061.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615603-1|AAU05060.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615602-1|AAU05059.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615601-1|AAU05058.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615600-1|AAU05057.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615599-1|AAU05056.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615598-1|AAU05055.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615597-1|AAU05054.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615596-1|AAU05053.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615595-1|AAU05052.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615594-1|AAU05051.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615593-1|AAU05050.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615592-1|AAU05049.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615591-1|AAU05048.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615590-1|AAU05047.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615589-1|AAU05046.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615588-1|AAU05045.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615587-1|AAU05044.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615586-1|AAU05043.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615585-1|AAU05042.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615584-1|AAU05041.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615583-1|AAU05040.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615582-1|AAU05039.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615581-1|AAU05038.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615580-1|AAU05037.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615579-1|AAU05036.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615578-1|AAU05035.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615577-1|AAU05034.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615576-1|AAU05033.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615575-1|AAU05032.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615574-1|AAU05031.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615573-1|AAU05030.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615572-1|AAU05029.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615571-1|AAU05028.1|   62|Anopheles gambiae sodium channel pro...    23   7.3  
AY615570-1|AAU05027.1|   71|Anopheles gambiae sodium channel pro...    23   7.3  
AY615569-1|AAU05026.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615568-1|AAU05025.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615567-1|AAU05024.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615566-1|AAU05023.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615565-1|AAU05022.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615564-1|AAU05021.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615563-1|AAU05020.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615562-1|AAU05019.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615561-1|AAU05018.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615560-1|AAU05017.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615559-1|AAU05016.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615558-1|AAU05015.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615557-1|AAU05014.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615556-1|AAU05013.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615555-1|AAU05012.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615554-1|AAU05011.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615553-1|AAU05010.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615552-1|AAU05009.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615551-1|AAU05008.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615550-1|AAU05007.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615549-1|AAU05006.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615548-1|AAU05005.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615547-1|AAU05004.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615546-1|AAU05003.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615545-1|AAU05002.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615544-1|AAU05001.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615543-1|AAU05000.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615542-1|AAU04999.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615541-1|AAU04998.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615540-1|AAU04997.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615539-1|AAU04996.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615538-1|AAU04995.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615537-1|AAU04994.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615536-1|AAU04993.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615535-1|AAU04992.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615534-1|AAU04991.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615533-1|AAU04990.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615532-1|AAU04989.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615531-1|AAU04988.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615530-1|AAU04987.1|   23|Anopheles gambiae sodium channel pro...    23   7.3  
AY615529-1|AAU04986.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615528-1|AAU04985.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615527-1|AAU04984.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AY615526-1|AAU04983.1|   22|Anopheles gambiae sodium channel pro...    23   7.3  
AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    23   7.3  

>AF387862-2|AAL56548.1|  942|Anopheles gambiae pol polyprotein
           protein.
          Length = 942

 Score = 25.8 bits (54), Expect = 1.0
 Identities = 21/48 (43%), Positives = 23/48 (47%), Gaps = 4/48 (8%)
 Frame = -1

Query: 155 RPTLGLRTLRGQDTEYW--PVSYF-RIVPSLRPRDP-PSRIPSLPFRP 24
           R  LG+R  RGQ+ EY     SY  RI       D  PSRIP  P  P
Sbjct: 658 RNYLGIRIERGQNGEYLLDQASYIRRIAKRFGQEDARPSRIPMDPGYP 705


>AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl
           symporter protein.
          Length = 1127

 Score = 23.8 bits (49), Expect = 4.2
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -2

Query: 73  CGHVTRHHASLPFR 32
           CGHVT+ H S  +R
Sbjct: 718 CGHVTKTHVSQKYR 731


>Y13592-1|CAA73920.1|  136|Anopheles gambiae voltage-gated sodium
           channel protein.
          Length = 136

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 44  NVDRFPDHDLPR 55


>AY615653-1|AAU05110.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615652-1|AAU05109.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615651-1|AAU05108.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615650-1|AAU05107.1|   62|Anopheles gambiae sodium channel
           protein.
          Length = 62

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615649-1|AAU05106.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615648-1|AAU05105.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615647-1|AAU05104.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615646-1|AAU05103.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615645-1|AAU05102.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615644-1|AAU05101.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615643-1|AAU05100.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615642-1|AAU05099.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615641-1|AAU05098.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615640-1|AAU05097.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615639-1|AAU05096.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615638-1|AAU05095.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615637-1|AAU05094.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615636-1|AAU05093.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615635-1|AAU05092.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615634-1|AAU05091.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615633-1|AAU05090.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615632-1|AAU05089.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615631-1|AAU05088.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615630-1|AAU05087.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615629-1|AAU05086.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615628-1|AAU05085.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615627-1|AAU05084.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615626-1|AAU05083.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615625-1|AAU05082.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615624-1|AAU05081.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615623-1|AAU05080.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615622-1|AAU05079.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615621-1|AAU05078.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615620-1|AAU05077.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615619-1|AAU05076.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615618-1|AAU05075.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615617-1|AAU05074.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615616-1|AAU05073.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615615-1|AAU05072.1|   69|Anopheles gambiae sodium channel
           protein.
          Length = 69

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615614-1|AAU05071.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615613-1|AAU05070.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615612-1|AAU05069.1|   69|Anopheles gambiae sodium channel
           protein.
          Length = 69

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615611-1|AAU05068.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615610-1|AAU05067.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615609-1|AAU05066.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615608-1|AAU05065.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615607-1|AAU05064.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615606-1|AAU05063.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615605-1|AAU05062.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615604-1|AAU05061.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615603-1|AAU05060.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615602-1|AAU05059.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615601-1|AAU05058.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615600-1|AAU05057.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615599-1|AAU05056.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615598-1|AAU05055.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615597-1|AAU05054.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615596-1|AAU05053.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615595-1|AAU05052.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615594-1|AAU05051.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615593-1|AAU05050.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615592-1|AAU05049.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615591-1|AAU05048.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615590-1|AAU05047.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615589-1|AAU05046.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615588-1|AAU05045.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615587-1|AAU05044.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615586-1|AAU05043.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615585-1|AAU05042.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615584-1|AAU05041.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615583-1|AAU05040.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615582-1|AAU05039.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615581-1|AAU05038.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615580-1|AAU05037.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615579-1|AAU05036.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615578-1|AAU05035.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615577-1|AAU05034.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615576-1|AAU05033.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615575-1|AAU05032.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615574-1|AAU05031.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615573-1|AAU05030.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615572-1|AAU05029.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615571-1|AAU05028.1|   62|Anopheles gambiae sodium channel
           protein.
          Length = 62

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615570-1|AAU05027.1|   71|Anopheles gambiae sodium channel
           protein.
          Length = 71

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615569-1|AAU05026.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615568-1|AAU05025.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615567-1|AAU05024.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615566-1|AAU05023.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615565-1|AAU05022.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615564-1|AAU05021.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615563-1|AAU05020.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615562-1|AAU05019.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615561-1|AAU05018.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615560-1|AAU05017.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615559-1|AAU05016.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615558-1|AAU05015.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615557-1|AAU05014.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615556-1|AAU05013.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615555-1|AAU05012.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615554-1|AAU05011.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615553-1|AAU05010.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615552-1|AAU05009.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615551-1|AAU05008.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615550-1|AAU05007.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615549-1|AAU05006.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615548-1|AAU05005.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615547-1|AAU05004.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615546-1|AAU05003.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615545-1|AAU05002.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615544-1|AAU05001.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615543-1|AAU05000.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615542-1|AAU04999.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615541-1|AAU04998.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615540-1|AAU04997.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615539-1|AAU04996.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615538-1|AAU04995.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615537-1|AAU04994.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615536-1|AAU04993.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615535-1|AAU04992.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615534-1|AAU04991.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615533-1|AAU04990.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615532-1|AAU04989.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615531-1|AAU04988.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615530-1|AAU04987.1|   23|Anopheles gambiae sodium channel
           protein.
          Length = 23

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615529-1|AAU04986.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615528-1|AAU04985.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615527-1|AAU04984.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AY615526-1|AAU04983.1|   22|Anopheles gambiae sodium channel
           protein.
          Length = 22

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 1   NVDRFPDHDLPR 12


>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
           channel alpha subunitprotein.
          Length = 2139

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 145 NVGRVPDHSVPR 180
           NV R PDH +PR
Sbjct: 959 NVDRFPDHDLPR 970


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 613,981
Number of Sequences: 2352
Number of extensions: 12453
Number of successful extensions: 201
Number of sequences better than 10.0: 132
Number of HSP's better than 10.0 without gapping: 200
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 201
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 56347938
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -