BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D13 (587 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 26 1.0 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 4.2 Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium... 23 7.3 AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel pro... 23 7.3 AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615645-1|AAU05102.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615644-1|AAU05101.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615643-1|AAU05100.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615642-1|AAU05099.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615641-1|AAU05098.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615640-1|AAU05097.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615639-1|AAU05096.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615638-1|AAU05095.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615637-1|AAU05094.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615636-1|AAU05093.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615635-1|AAU05092.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615634-1|AAU05091.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615633-1|AAU05090.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615632-1|AAU05089.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615631-1|AAU05088.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615630-1|AAU05087.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615629-1|AAU05086.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615627-1|AAU05084.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615626-1|AAU05083.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615625-1|AAU05082.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615624-1|AAU05081.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615623-1|AAU05080.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615622-1|AAU05079.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615621-1|AAU05078.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615620-1|AAU05077.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615619-1|AAU05076.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel pro... 23 7.3 AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615613-1|AAU05070.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel pro... 23 7.3 AY615611-1|AAU05068.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615607-1|AAU05064.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615606-1|AAU05063.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615605-1|AAU05062.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615604-1|AAU05061.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615603-1|AAU05060.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615602-1|AAU05059.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615601-1|AAU05058.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615600-1|AAU05057.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615599-1|AAU05056.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615598-1|AAU05055.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615597-1|AAU05054.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615596-1|AAU05053.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615595-1|AAU05052.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615594-1|AAU05051.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615593-1|AAU05050.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615592-1|AAU05049.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615591-1|AAU05048.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615590-1|AAU05047.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615589-1|AAU05046.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615588-1|AAU05045.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615587-1|AAU05044.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615586-1|AAU05043.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615585-1|AAU05042.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615584-1|AAU05041.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615583-1|AAU05040.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615582-1|AAU05039.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615581-1|AAU05038.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615580-1|AAU05037.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615579-1|AAU05036.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615578-1|AAU05035.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615577-1|AAU05034.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615576-1|AAU05033.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615575-1|AAU05032.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615574-1|AAU05031.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615573-1|AAU05030.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615572-1|AAU05029.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel pro... 23 7.3 AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel pro... 23 7.3 AY615569-1|AAU05026.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615568-1|AAU05025.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615567-1|AAU05024.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615566-1|AAU05023.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615565-1|AAU05022.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615564-1|AAU05021.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615563-1|AAU05020.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615562-1|AAU05019.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615561-1|AAU05018.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615560-1|AAU05017.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615559-1|AAU05016.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615558-1|AAU05015.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615557-1|AAU05014.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615556-1|AAU05013.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615555-1|AAU05012.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615554-1|AAU05011.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615553-1|AAU05010.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615552-1|AAU05009.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615551-1|AAU05008.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615550-1|AAU05007.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615549-1|AAU05006.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615548-1|AAU05005.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615547-1|AAU05004.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615546-1|AAU05003.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615545-1|AAU05002.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615544-1|AAU05001.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615543-1|AAU05000.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615542-1|AAU04999.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615541-1|AAU04998.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615540-1|AAU04997.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615539-1|AAU04996.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615538-1|AAU04995.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615537-1|AAU04994.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615536-1|AAU04993.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615535-1|AAU04992.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615534-1|AAU04991.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615533-1|AAU04990.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615532-1|AAU04989.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615531-1|AAU04988.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615530-1|AAU04987.1| 23|Anopheles gambiae sodium channel pro... 23 7.3 AY615529-1|AAU04986.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615528-1|AAU04985.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615527-1|AAU04984.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AY615526-1|AAU04983.1| 22|Anopheles gambiae sodium channel pro... 23 7.3 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.3 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 25.8 bits (54), Expect = 1.0 Identities = 21/48 (43%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = -1 Query: 155 RPTLGLRTLRGQDTEYW--PVSYF-RIVPSLRPRDP-PSRIPSLPFRP 24 R LG+R RGQ+ EY SY RI D PSRIP P P Sbjct: 658 RNYLGIRIERGQNGEYLLDQASYIRRIAKRFGQEDARPSRIPMDPGYP 705 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 73 CGHVTRHHASLPFR 32 CGHVT+ H S +R Sbjct: 718 CGHVTKTHVSQKYR 731 >Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium channel protein. Length = 136 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 44 NVDRFPDHDLPR 55 >AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615645-1|AAU05102.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615644-1|AAU05101.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615643-1|AAU05100.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615642-1|AAU05099.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615641-1|AAU05098.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615640-1|AAU05097.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615639-1|AAU05096.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615638-1|AAU05095.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615637-1|AAU05094.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615636-1|AAU05093.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615635-1|AAU05092.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615634-1|AAU05091.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615633-1|AAU05090.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615632-1|AAU05089.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615631-1|AAU05088.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615630-1|AAU05087.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615629-1|AAU05086.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615627-1|AAU05084.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615626-1|AAU05083.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615625-1|AAU05082.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615624-1|AAU05081.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615623-1|AAU05080.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615622-1|AAU05079.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615621-1|AAU05078.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615620-1|AAU05077.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615619-1|AAU05076.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615613-1|AAU05070.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615611-1|AAU05068.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615607-1|AAU05064.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615606-1|AAU05063.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615605-1|AAU05062.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615604-1|AAU05061.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615603-1|AAU05060.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615602-1|AAU05059.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615601-1|AAU05058.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615600-1|AAU05057.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615599-1|AAU05056.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615598-1|AAU05055.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615597-1|AAU05054.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615596-1|AAU05053.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615595-1|AAU05052.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615594-1|AAU05051.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615593-1|AAU05050.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615592-1|AAU05049.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615591-1|AAU05048.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615590-1|AAU05047.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615589-1|AAU05046.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615588-1|AAU05045.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615587-1|AAU05044.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615586-1|AAU05043.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615585-1|AAU05042.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615584-1|AAU05041.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615583-1|AAU05040.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615582-1|AAU05039.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615581-1|AAU05038.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615580-1|AAU05037.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615579-1|AAU05036.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615578-1|AAU05035.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615577-1|AAU05034.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615576-1|AAU05033.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615575-1|AAU05032.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615574-1|AAU05031.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615573-1|AAU05030.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615572-1|AAU05029.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615569-1|AAU05026.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615568-1|AAU05025.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615567-1|AAU05024.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615566-1|AAU05023.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615565-1|AAU05022.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615564-1|AAU05021.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615563-1|AAU05020.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615562-1|AAU05019.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615561-1|AAU05018.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615560-1|AAU05017.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615559-1|AAU05016.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615558-1|AAU05015.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615557-1|AAU05014.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615556-1|AAU05013.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615555-1|AAU05012.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615554-1|AAU05011.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615553-1|AAU05010.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615552-1|AAU05009.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615551-1|AAU05008.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615550-1|AAU05007.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615549-1|AAU05006.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615548-1|AAU05005.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615547-1|AAU05004.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615546-1|AAU05003.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615545-1|AAU05002.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615544-1|AAU05001.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615543-1|AAU05000.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615542-1|AAU04999.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615541-1|AAU04998.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615540-1|AAU04997.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615539-1|AAU04996.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615538-1|AAU04995.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615537-1|AAU04994.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615536-1|AAU04993.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615535-1|AAU04992.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615534-1|AAU04991.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615533-1|AAU04990.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615532-1|AAU04989.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615531-1|AAU04988.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615530-1|AAU04987.1| 23|Anopheles gambiae sodium channel protein. Length = 23 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615529-1|AAU04986.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615528-1|AAU04985.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615527-1|AAU04984.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AY615526-1|AAU04983.1| 22|Anopheles gambiae sodium channel protein. Length = 22 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 1 NVDRFPDHDLPR 12 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 145 NVGRVPDHSVPR 180 NV R PDH +PR Sbjct: 959 NVDRFPDHDLPR 970 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,981 Number of Sequences: 2352 Number of extensions: 12453 Number of successful extensions: 201 Number of sequences better than 10.0: 132 Number of HSP's better than 10.0 without gapping: 200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 201 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -