BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D11 (327 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D560E4 Cluster: PREDICTED: similar to Inter-alph... 53 1e-06 UniRef50_Q6PGW2 Cluster: Zgc:112265 protein; n=11; Clupeocephala... 47 9e-05 UniRef50_UPI0000E1FD23 Cluster: PREDICTED: inter-alpha (globulin... 42 0.003 UniRef50_UPI0000E460BF Cluster: PREDICTED: similar to inter-alph... 41 0.006 UniRef50_UPI0000D56533 Cluster: PREDICTED: similar to Inter-alph... 40 0.008 UniRef50_Q503P4 Cluster: Zgc:110377; n=9; Euteleostomi|Rep: Zgc:... 40 0.011 UniRef50_UPI00006A1915 Cluster: Transmembrane protein 110.; n=4;... 40 0.014 UniRef50_Q1PBV1 Cluster: Inter-alpha globulin inhibitor H4; n=1;... 40 0.014 UniRef50_Q14624 Cluster: Inter-alpha-trypsin inhibitor heavy cha... 39 0.019 UniRef50_UPI000155CC23 Cluster: PREDICTED: similar to ITI-like p... 39 0.024 UniRef50_Q498Q0 Cluster: Zgc:113924; n=5; Danio rerio|Rep: Zgc:1... 39 0.024 UniRef50_UPI0000F2E846 Cluster: PREDICTED: similar to ITI-like p... 38 0.043 UniRef50_UPI0000E4606A Cluster: PREDICTED: similar to LOC594926 ... 38 0.043 UniRef50_Q4S685 Cluster: Chromosome 9 SCAF14729, whole genome sh... 37 0.075 UniRef50_UPI0000EB3907 Cluster: Transmembrane protein 110.; n=3;... 37 0.099 UniRef50_P79263 Cluster: Inter-alpha-trypsin inhibitor heavy cha... 37 0.099 UniRef50_Q4SBF6 Cluster: Chromosome 11 SCAF14674, whole genome s... 36 0.13 UniRef50_Q6UXX5 Cluster: Inter-alpha-trypsin inhibitor heavy cha... 36 0.13 UniRef50_UPI000065DA1D Cluster: Homolog of Homo sapiens "Inter-a... 36 0.17 UniRef50_UPI000065F8E3 Cluster: inter-alpha (globulin) inhibitor... 35 0.30 UniRef50_Q7R5U3 Cluster: GLP_81_150413_159181; n=1; Giardia lamb... 34 0.70 UniRef50_UPI0000D8C94A Cluster: Novel protein similar to vertebr... 33 1.6 UniRef50_Q9SLV0 Cluster: ZF14 protein; n=8; Magnoliophyta|Rep: Z... 32 2.1 UniRef50_A0BL37 Cluster: Chromosome undetermined scaffold_113, w... 32 2.1 UniRef50_UPI0000F2C403 Cluster: PREDICTED: hypothetical protein;... 32 2.8 UniRef50_Q4S5G0 Cluster: Chromosome 19 SCAF14731, whole genome s... 32 2.8 UniRef50_Q0LDQ2 Cluster: Major facilitator superfamily MFS_1; n=... 32 2.8 UniRef50_Q53JU6 Cluster: Retrotransposon protein, putative, Ty3-... 32 2.8 UniRef50_UPI000065D60D Cluster: inter-alpha trypsin inhibitor he... 31 3.7 UniRef50_UPI000065D13D Cluster: Rab-interacting lysosomal protei... 31 3.7 UniRef50_A0FRR0 Cluster: Putative uncharacterized protein; n=1; ... 31 3.7 UniRef50_Q9SCZ4 Cluster: Receptor-protein kinase-like protein; n... 31 3.7 UniRef50_A7QFM6 Cluster: Chromosome chr8 scaffold_88, whole geno... 31 4.9 UniRef50_Q29BE8 Cluster: GA17373-PA; n=1; Drosophila pseudoobscu... 31 4.9 UniRef50_A0CF81 Cluster: Chromosome undetermined scaffold_174, w... 31 4.9 UniRef50_A0YVR8 Cluster: Type I restriction-modification system,... 31 6.5 UniRef50_Q0J087 Cluster: Os09g0524300 protein; n=11; Oryza|Rep: ... 31 6.5 UniRef50_Q5ADE8 Cluster: Potential zinc finger protein; n=3; Can... 31 6.5 UniRef50_A4RDH1 Cluster: Putative uncharacterized protein; n=2; ... 31 6.5 UniRef50_UPI00006CA43C Cluster: Protein kinase domain containing... 30 8.6 UniRef50_Q5RHF3 Cluster: Novel protein similar to vertebrate int... 30 8.6 UniRef50_Q01JM2 Cluster: OSIGBa0127A14.5 protein; n=5; Oryza sat... 30 8.6 UniRef50_Q4FW24 Cluster: Putative uncharacterized protein; n=3; ... 30 8.6 UniRef50_Q4DHZ4 Cluster: Putative uncharacterized protein; n=2; ... 30 8.6 UniRef50_Q8NDB6 Cluster: Transmembrane protein 29; n=10; Eutheri... 30 8.6 UniRef50_Q5VZB9 Cluster: Doublesex- and mab-3-related transcript... 30 8.6 >UniRef50_UPI0000D560E4 Cluster: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P...; n=4; Tribolium castaneum|Rep: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P... - Tribolium castaneum Length = 842 Score = 53.2 bits (122), Expect = 1e-06 Identities = 26/49 (53%), Positives = 37/49 (75%), Gaps = 4/49 (8%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNETNAVNAE----SVDKPAFQESSFAS 192 AL +ALKY FVTP++SLVVVKPN+T+AV+ E + D+P F ++A+ Sbjct: 623 ALDIALKYSFVTPVSSLVVVKPNDTSAVDTEDASKTADRPYFLNRNYAT 671 >UniRef50_Q6PGW2 Cluster: Zgc:112265 protein; n=11; Clupeocephala|Rep: Zgc:112265 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 927 Score = 46.8 bits (106), Expect = 9e-05 Identities = 37/104 (35%), Positives = 47/104 (45%), Gaps = 16/104 (15%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNETNAVNA----ESVDKPAFQESSFASVPV-------- 201 AL L+LKY+FVTPLTS+VV KP E A E + P + S VP Sbjct: 566 ALQLSLKYQFVTPLTSMVVTKPQEGEVDVADKPKEGGESPRYPASQPRLVPYGRSGTPGF 625 Query: 202 ----YDISNVRPGTVALQSLPSPQLTADTSYQYQPLSIPAYNRF 321 Y ++ +PG AL LP P D S Y S ++ F Sbjct: 626 SHHHYTTNSGQPGLHALPGLPGPPGPPDASISYGRFSGGSHRAF 669 >UniRef50_UPI0000E1FD23 Cluster: PREDICTED: inter-alpha (globulin) inhibitor H3 isoform 2; n=6; Amniota|Rep: PREDICTED: inter-alpha (globulin) inhibitor H3 isoform 2 - Pan troglodytes Length = 865 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNETNAVNAESVDKP 165 AL L+LKY FVTPLTS+VV KP E N DKP Sbjct: 560 ALDLSLKYHFVTPLTSMVVTKP-EDNEDERAIADKP 594 >UniRef50_UPI0000E460BF Cluster: PREDICTED: similar to inter-alpha-trypsin inhibitor heavy chain3; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to inter-alpha-trypsin inhibitor heavy chain3 - Strongylocentrotus purpuratus Length = 1028 Score = 40.7 bits (91), Expect = 0.006 Identities = 27/75 (36%), Positives = 38/75 (50%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNETNAVNAESVDKPAFQESSFASVPVYDISNVRPGTVA 237 AL L+LKY FVTPLTSL+VVKP+ + + + D A E A Sbjct: 658 ALNLSLKYHFVTPLTSLLVVKPDVVDR-DVQGGDTEADGEDDDADKGTQQPPPPSNPPNR 716 Query: 238 LQSLPSPQLTADTSY 282 +++PSP + A S+ Sbjct: 717 RKTVPSPNIPAAPSF 731 >UniRef50_UPI0000D56533 Cluster: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P...; n=5; Tribolium castaneum|Rep: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P... - Tribolium castaneum Length = 698 Score = 40.3 bits (90), Expect = 0.008 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNETNAVNAESVD 159 AL LALKY FVT +TSLVVVKP + + E+VD Sbjct: 577 ALNLALKYSFVTSVTSLVVVKPQQNETL--ENVD 608 >UniRef50_Q503P4 Cluster: Zgc:110377; n=9; Euteleostomi|Rep: Zgc:110377 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 868 Score = 39.9 bits (89), Expect = 0.011 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNE 129 AL+L+LKY FVTPLTS+VV KP + Sbjct: 558 ALSLSLKYNFVTPLTSMVVTKPED 581 >UniRef50_UPI00006A1915 Cluster: Transmembrane protein 110.; n=4; Xenopus tropicalis|Rep: Transmembrane protein 110. - Xenopus tropicalis Length = 728 Score = 39.5 bits (88), Expect = 0.014 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNETNAVNAESVDKP 165 AL L+LKY FVTP+TS+VV P +T+ +KP Sbjct: 548 ALELSLKYNFVTPITSMVVTAPEDTDENKELIANKP 583 >UniRef50_Q1PBV1 Cluster: Inter-alpha globulin inhibitor H4; n=1; Marmota monax|Rep: Inter-alpha globulin inhibitor H4 - Marmota monax (Woodchuck) Length = 157 Score = 39.5 bits (88), Expect = 0.014 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNETNAVNAESVDKPAFQESSFASVPV-YDIS 213 AL L+L+Y FVTPLTS+VV KP ++ +KP ++ ++ YD+S Sbjct: 37 ALNLSLEYNFVTPLTSMVVTKPE--GQEQSQVAEKPVEDDNRHRNINTGYDLS 87 >UniRef50_Q14624 Cluster: Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (PK-120) (GP120) [Contains: 70 kDa inter-alpha-trypsin inhibitor heavy chain H4; 35 kDa inter-alpha- trypsin inhibitor heavy chain H4]; n=27; Eutheria|Rep: Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (PK-120) (GP120) [Contains: 70 kDa inter-alpha-trypsin inhibitor heavy chain H4; 35 kDa inter-alpha- trypsin inhibitor heavy chain H4] - Homo sapiens (Human) Length = 930 Score = 39.1 bits (87), Expect = 0.019 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNETNAVNAESVDKPAFQES 180 AL L+L Y FVTPLTS+VV KP++ ++ +KP ES Sbjct: 575 ALNLSLAYSFVTPLTSMVVTKPDDQE--QSQVAEKPMEGES 613 >UniRef50_UPI000155CC23 Cluster: PREDICTED: similar to ITI-like protein; n=3; Amniota|Rep: PREDICTED: similar to ITI-like protein - Ornithorhynchus anatinus Length = 1374 Score = 38.7 bits (86), Expect = 0.024 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNE 129 A L+LKY FVTP+TSLVVV+P E Sbjct: 625 ATNLSLKYNFVTPVTSLVVVRPEE 648 >UniRef50_Q498Q0 Cluster: Zgc:113924; n=5; Danio rerio|Rep: Zgc:113924 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 892 Score = 38.7 bits (86), Expect = 0.024 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKP 123 AL L+LKY+FVTPLTS+VV KP Sbjct: 558 ALDLSLKYKFVTPLTSMVVTKP 579 >UniRef50_UPI0000F2E846 Cluster: PREDICTED: similar to ITI-like protein, partial; n=1; Monodelphis domestica|Rep: PREDICTED: similar to ITI-like protein, partial - Monodelphis domestica Length = 1002 Score = 37.9 bits (84), Expect = 0.043 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPNE 129 AL L+L + FVTPLTSLVVV+P E Sbjct: 594 ALNLSLHFHFVTPLTSLVVVRPEE 617 >UniRef50_UPI0000E4606A Cluster: PREDICTED: similar to LOC594926 protein, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to LOC594926 protein, partial - Strongylocentrotus purpuratus Length = 338 Score = 37.9 bits (84), Expect = 0.043 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = +1 Query: 61 LTLALKYEFVTPLTSLVVVKPN 126 + L+LKY FVTPLTSL+VVKP+ Sbjct: 281 INLSLKYHFVTPLTSLLVVKPD 302 >UniRef50_Q4S685 Cluster: Chromosome 9 SCAF14729, whole genome shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 9 SCAF14729, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 608 Score = 37.1 bits (82), Expect = 0.075 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPN 126 A L+L+Y FVTP+TSLVVVKP+ Sbjct: 586 ATNLSLRYNFVTPVTSLVVVKPD 608 >UniRef50_UPI0000EB3907 Cluster: Transmembrane protein 110.; n=3; Mammalia|Rep: Transmembrane protein 110. - Canis familiaris Length = 581 Score = 36.7 bits (81), Expect = 0.099 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKP 123 AL L+L Y FVTPLTS+VV KP Sbjct: 481 ALNLSLSYSFVTPLTSMVVTKP 502 >UniRef50_P79263 Cluster: Inter-alpha-trypsin inhibitor heavy chain H4 precursor; n=7; Euteleostomi|Rep: Inter-alpha-trypsin inhibitor heavy chain H4 precursor - Sus scrofa (Pig) Length = 921 Score = 36.7 bits (81), Expect = 0.099 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKP 123 AL+L+L Y FVTPLTS+V+ KP Sbjct: 571 ALSLSLNYSFVTPLTSMVITKP 592 >UniRef50_Q4SBF6 Cluster: Chromosome 11 SCAF14674, whole genome shotgun sequence; n=7; Euteleostomi|Rep: Chromosome 11 SCAF14674, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1039 Score = 36.3 bits (80), Expect = 0.13 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKP 123 AL ++L+Y FVTPLTS+VV KP Sbjct: 734 ALDMSLRYSFVTPLTSMVVTKP 755 >UniRef50_Q6UXX5 Cluster: Inter-alpha-trypsin inhibitor heavy chain H5-like protein precursor; n=12; Euarchontoglires|Rep: Inter-alpha-trypsin inhibitor heavy chain H5-like protein precursor - Homo sapiens (Human) Length = 1313 Score = 36.3 bits (80), Expect = 0.13 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +1 Query: 61 LTLALKYEFVTPLTSLVVVKPNETN 135 L L+L+Y FVTPLTSLV+V+P + + Sbjct: 593 LNLSLEYNFVTPLTSLVMVQPKQAS 617 >UniRef50_UPI000065DA1D Cluster: Homolog of Homo sapiens "Inter-alpha (globulIn) InhIbItor H3; n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens "Inter-alpha (globulIn) InhIbItor H3 - Takifugu rubripes Length = 748 Score = 35.9 bits (79), Expect = 0.17 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKP 123 AL ++L+Y FVTPLTS+VV KP Sbjct: 503 ALDMSLQYSFVTPLTSMVVTKP 524 >UniRef50_UPI000065F8E3 Cluster: inter-alpha (globulin) inhibitor H5-like; n=1; Takifugu rubripes|Rep: inter-alpha (globulin) inhibitor H5-like - Takifugu rubripes Length = 776 Score = 35.1 bits (77), Expect = 0.30 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKP 123 A L+L+Y FVTP+TSLVVV+P Sbjct: 554 ATNLSLRYNFVTPVTSLVVVQP 575 >UniRef50_Q7R5U3 Cluster: GLP_81_150413_159181; n=1; Giardia lamblia ATCC 50803|Rep: GLP_81_150413_159181 - Giardia lamblia ATCC 50803 Length = 2922 Score = 33.9 bits (74), Expect = 0.70 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = -2 Query: 233 TVPGLTLEISYTGTDANEDS*KAGLSTDSAFT-AFVSFGFTTTKDVRGVTNSYFRAN 66 TVP L L++ TD N+ A DS T F+S GF TT D + + +F N Sbjct: 931 TVPTLVLDLEPVSTDGNQTITAAAAVADSIITRRFLSQGFFTTSDRQEMDFLHFEFN 987 >UniRef50_UPI0000D8C94A Cluster: Novel protein similar to vertebrate inter-alpha (Globulin) inhibitor H family (Plasma Kallikrein-sensitive glycoprotein) (ITIH); n=1; Danio rerio|Rep: Novel protein similar to vertebrate inter-alpha (Globulin) inhibitor H family (Plasma Kallikrein-sensitive glycoprotein) (ITIH) - Danio rerio Length = 745 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPN 126 A L+L+ FVTP+TSLVV+KP+ Sbjct: 492 ATNLSLENNFVTPVTSLVVIKPD 514 >UniRef50_Q9SLV0 Cluster: ZF14 protein; n=8; Magnoliophyta|Rep: ZF14 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 532 Score = 32.3 bits (70), Expect = 2.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 290 WYWYEVSAVNCGLGSDCRATVPGLTLEISYT 198 W+WYE + CGL ++ RATV + + I T Sbjct: 298 WWWYEFMIILCGLLANPRATVASMGILIQTT 328 >UniRef50_A0BL37 Cluster: Chromosome undetermined scaffold_113, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_113, whole genome shotgun sequence - Paramecium tetraurelia Length = 1130 Score = 32.3 bits (70), Expect = 2.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 284 WYEVSAVNCGLGSDCRATVPGLTLEISYTGTDANED 177 WYE S NC +DC + G + +I+Y D N + Sbjct: 166 WYETSISNCKTYNDCFDYISGYSPQIAYPKLDLNNE 201 >UniRef50_UPI0000F2C403 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 762 Score = 31.9 bits (69), Expect = 2.8 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 109 VVVKPNETNAVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSP 258 V + P E N++ DK F S A+ V D+ ++ PG Q + SP Sbjct: 225 VHIMPGEKNSLVCRKEDKAVFVPRSGAAGGVKDLESLAPGPTCFQGVSSP 274 >UniRef50_Q4S5G0 Cluster: Chromosome 19 SCAF14731, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 19 SCAF14731, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 993 Score = 31.9 bits (69), Expect = 2.8 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKP 123 A L+L Y F+TPLT+LVV KP Sbjct: 644 ATNLSLTYHFLTPLTNLVVEKP 665 >UniRef50_Q0LDQ2 Cluster: Major facilitator superfamily MFS_1; n=1; Herpetosiphon aurantiacus ATCC 23779|Rep: Major facilitator superfamily MFS_1 - Herpetosiphon aurantiacus ATCC 23779 Length = 438 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -1 Query: 225 WSNVGNIIYRDRCKRRFLKSRFINRFRVHCIRFIWFHYYQR 103 W+++ NI+ RDR R FL SR I++ + F + QR Sbjct: 231 WASIANILKRDRNFRWFLASRIISQLGLMATAFFTVYAVQR 271 >UniRef50_Q53JU6 Cluster: Retrotransposon protein, putative, Ty3-gypsy sub-class; n=1; Oryza sativa (japonica cultivar-group)|Rep: Retrotransposon protein, putative, Ty3-gypsy sub-class - Oryza sativa subsp. japonica (Rice) Length = 578 Score = 31.9 bits (69), Expect = 2.8 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = -1 Query: 243 LQSYGSWSNVGNIIYRDRCKRRFLKSRFINRFRVHCIRFIWFHYYQRRQRCDKFIL 76 LQ S + +G I++ D C+ +LK+ + + C R + FH + + D +++ Sbjct: 361 LQLQSSLNTLGYILFDDSCELNYLKAIILTHSDLPCPRNVIFHIFGKYNDSDIYLV 416 >UniRef50_UPI000065D60D Cluster: inter-alpha trypsin inhibitor heavy chain precursor 5 isoform 1; n=1; Takifugu rubripes|Rep: inter-alpha trypsin inhibitor heavy chain precursor 5 isoform 1 - Takifugu rubripes Length = 1071 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKPN 126 A L+L Y F+TPLT++VV KP+ Sbjct: 744 ATNLSLTYNFLTPLTNMVVEKPS 766 >UniRef50_UPI000065D13D Cluster: Rab-interacting lysosomal protein.; n=1; Takifugu rubripes|Rep: Rab-interacting lysosomal protein. - Takifugu rubripes Length = 309 Score = 31.5 bits (68), Expect = 3.7 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 130 TNAVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQLTADTS 279 T ++ ++ P + P Y +S +PGT L SP LTA S Sbjct: 178 TMQLDKTNIKDPVLMPLNSVQTPKYHVSKCKPGTSPLSHQSSPHLTAPVS 227 >UniRef50_A0FRR0 Cluster: Putative uncharacterized protein; n=1; Burkholderia phymatum STM815|Rep: Putative uncharacterized protein - Burkholderia phymatum STM815 Length = 349 Score = 31.5 bits (68), Expect = 3.7 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 2/76 (2%) Frame = -2 Query: 299 DNGWYWYEVSAV-NCGLGSDCRATVPGLTLEISYTGTDANEDS*KAGLSTDSAFTAFVSF 123 DN W+W+E V N V G TLE+S T +G S + A +F Sbjct: 137 DNNWHWFEAKVVLNTASTGSVTCYVDG-TLELSLTSLATISAGTPSGFVLGSLYQANTNF 195 Query: 122 GFTTTKDVRGVT-NSY 78 T D G NS+ Sbjct: 196 DDVTFWDTSGAAFNSF 211 >UniRef50_Q9SCZ4 Cluster: Receptor-protein kinase-like protein; n=37; Magnoliophyta|Rep: Receptor-protein kinase-like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 895 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +1 Query: 136 AVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQLTADTSYQYQP 294 A++ V+KP + +S V ++ ++ +P PQ+TAD S +P Sbjct: 385 ALHPNPVNKPEYYDSLLNGVEIFKMNTSDGNLAGTNPIPGPQVTADPSKVLRP 437 >UniRef50_A7QFM6 Cluster: Chromosome chr8 scaffold_88, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr8 scaffold_88, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 615 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 290 WYWYEVSAVNCGLGSDCRATVPGLTLEISYTG 195 W+WYE+ CGL S+ A++ + + I TG Sbjct: 284 WWWYEIMLFLCGLLSNPEASLAAMGIIIQTTG 315 >UniRef50_Q29BE8 Cluster: GA17373-PA; n=1; Drosophila pseudoobscura|Rep: GA17373-PA - Drosophila pseudoobscura (Fruit fly) Length = 335 Score = 31.1 bits (67), Expect = 4.9 Identities = 20/74 (27%), Positives = 30/74 (40%) Frame = +1 Query: 82 EFVTPLTSLVVVKPNETNAVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQ 261 EF+ T L+ + N + + KP + S P + P V L S PQ Sbjct: 24 EFIFVQTKLITPRYALENRILTTRLKKPWARTKSAILAPAAKVERPPPKIVPLPSRTGPQ 83 Query: 262 LTADTSYQYQPLSI 303 T +TSY + +I Sbjct: 84 KTPETSYPVRERAI 97 >UniRef50_A0CF81 Cluster: Chromosome undetermined scaffold_174, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_174, whole genome shotgun sequence - Paramecium tetraurelia Length = 773 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/38 (31%), Positives = 26/38 (68%) Frame = -1 Query: 243 LQSYGSWSNVGNIIYRDRCKRRFLKSRFINRFRVHCIR 130 ++ + +WS G +IY+D+C R F++++ N +V C++ Sbjct: 9 IEQHITWSVQGQMIYKDQCTRCFVEAKSDNGIQV-CLK 45 >UniRef50_A0YVR8 Cluster: Type I restriction-modification system, M subunit, putative; n=2; Cyanobacteria|Rep: Type I restriction-modification system, M subunit, putative - Lyngbya sp. PCC 8106 Length = 1045 Score = 30.7 bits (66), Expect = 6.5 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = -3 Query: 214 WKYHIQGPMQTKILEKPVYQQIPRSLHSFHLVSLLPKTSEV*QIHTSELTLKLSFQD 44 W + + P + I+ KPV R + SF+ VSL + +E ++H ++L FQ+ Sbjct: 114 WTCYEEPPKEDDII-KPVINVSKREIESFNQVSLSGQAAETLRLHWADLVSGQFFQE 169 >UniRef50_Q0J087 Cluster: Os09g0524300 protein; n=11; Oryza|Rep: Os09g0524300 protein - Oryza sativa subsp. japonica (Rice) Length = 565 Score = 30.7 bits (66), Expect = 6.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 290 WYWYEVSAVNCGLGSDCRATVPGLTLEISYT 198 W+WYE+ + CG+ +D +A V + + I T Sbjct: 321 WWWYEIMVLLCGVLADPKAAVAAMGVLIQTT 351 >UniRef50_Q5ADE8 Cluster: Potential zinc finger protein; n=3; Candida albicans|Rep: Potential zinc finger protein - Candida albicans (Yeast) Length = 949 Score = 30.7 bits (66), Expect = 6.5 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 193 VPVYDISNVRPGTVALQSLPSPQLTADTSYQYQPLSIPAYN 315 VP D S R G+++ +P+P A SY Y P S +Y+ Sbjct: 435 VPRNDTSADRTGSLSASPIPAPNNPATHSYPYYPYSQSSYH 475 >UniRef50_A4RDH1 Cluster: Putative uncharacterized protein; n=2; Sordariomycetes|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 737 Score = 30.7 bits (66), Expect = 6.5 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +1 Query: 160 KPAFQESSFASVPVYDISNVRP-GTVALQSLPSPQLTADTSYQYQ 291 KP FQES A +P++ RP TV+++++ SP L+ +T +Q Sbjct: 503 KPNFQESRSAQLPMH---QPRPQKTVSVETIESPTLSGNTPQSFQ 544 >UniRef50_UPI00006CA43C Cluster: Protein kinase domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Protein kinase domain containing protein - Tetrahymena thermophila SB210 Length = 2353 Score = 30.3 bits (65), Expect = 8.6 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 85 FVTPLTSLVVVKPNETNAVNAESVDKPAFQESS 183 F+T +T +++ PN+ N N V K ESS Sbjct: 1433 FITDITKFMILNPNQNNQFNQSEVQKNKKDESS 1465 >UniRef50_Q5RHF3 Cluster: Novel protein similar to vertebrate inter-alpha (Globulin) inhibitor H5; n=5; Danio rerio|Rep: Novel protein similar to vertebrate inter-alpha (Globulin) inhibitor H5 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 906 Score = 30.3 bits (65), Expect = 8.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 58 ALTLALKYEFVTPLTSLVVVKP 123 A L+L Y F+TPLT ++V KP Sbjct: 562 ATNLSLTYNFLTPLTQMIVEKP 583 >UniRef50_Q01JM2 Cluster: OSIGBa0127A14.5 protein; n=5; Oryza sativa|Rep: OSIGBa0127A14.5 protein - Oryza sativa (Rice) Length = 560 Score = 30.3 bits (65), Expect = 8.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 290 WYWYEVSAVNCGLGSDCRATVPGLTLEISYT 198 W+WYE+ + CGL + +ATV + + I T Sbjct: 322 WWWYEIMILLCGLLLNPQATVASMGILIQTT 352 >UniRef50_Q4FW24 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania major strain Friedlin Length = 264 Score = 30.3 bits (65), Expect = 8.6 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 97 LTSLVVVKPNETNAVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQ 261 + S+V V ++ N V A +P + +P + +S V P TVA Q + +PQ Sbjct: 14 MASIVYVPSSQPNPV-AYYAAEPVINPQTIQQLPQHRVSLVYPDTVAQQRIQAPQ 67 >UniRef50_Q4DHZ4 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 1081 Score = 30.3 bits (65), Expect = 8.6 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 243 LQSYGSWSNVGNIIYRDRCKRRFLKSRFINR 151 L +YG N + IY + CK+R+LKS I R Sbjct: 890 LFNYGGTMNTLSFIYSEYCKKRYLKSLHIFR 920 >UniRef50_Q8NDB6 Cluster: Transmembrane protein 29; n=10; Eutheria|Rep: Transmembrane protein 29 - Homo sapiens (Human) Length = 213 Score = 30.3 bits (65), Expect = 8.6 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +1 Query: 94 PLTSLVVVKPNETNAVNAE--SVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQ 261 PL P++++ + A S + PA + S++ P+ +SN+ PG Q++P P+ Sbjct: 3 PLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPE 60 >UniRef50_Q5VZB9 Cluster: Doublesex- and mab-3-related transcription factor A1; n=31; Eumetazoa|Rep: Doublesex- and mab-3-related transcription factor A1 - Homo sapiens (Human) Length = 504 Score = 30.3 bits (65), Expect = 8.6 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 118 KPNETNAVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQLTADTSY 282 KP+ N N+E ++ AFQ +S + ++ + GT+ +S SP T SY Sbjct: 370 KPDNRNLANSEELENTAFQRAS-----SFSLAGIGFGTLGNKSAFSPLQTTSASY 419 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.312 0.128 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 296,816,904 Number of Sequences: 1657284 Number of extensions: 5410292 Number of successful extensions: 11644 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 11406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11638 length of database: 575,637,011 effective HSP length: 85 effective length of database: 434,767,871 effective search space used: 9999661033 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -