BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D10 (482 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q75WP3 Cluster: Alginate lyase; n=1; Sphingomonas sp. A... 34 1.5 UniRef50_A3HYS6 Cluster: Small GTP-binding protein domain; n=1; ... 33 2.6 >UniRef50_Q75WP3 Cluster: Alginate lyase; n=1; Sphingomonas sp. A1|Rep: Alginate lyase - Sphingomonas sp. A1 Length = 308 Score = 34.3 bits (75), Expect = 1.5 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -2 Query: 214 LCYC*QYFRHTTGGALRYYPPTSGGTVSHQPHVRS 110 L Y QYF T GA+ ++ PT+GGT ++ + RS Sbjct: 113 LGYTSQYFYTDTDGAMTFWAPTTGGTTANSSYPRS 147 >UniRef50_A3HYS6 Cluster: Small GTP-binding protein domain; n=1; Algoriphagus sp. PR1|Rep: Small GTP-binding protein domain - Algoriphagus sp. PR1 Length = 615 Score = 33.5 bits (73), Expect = 2.6 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +2 Query: 359 IICS*YKNVRYLDITNSHFSLI*FDYFQLTQCDTRFVT 472 +I Y ++YLD++++HF+ I D+ LT+ DT ++ Sbjct: 274 VITKSYHKLKYLDLSHNHFTTIPEDFGNLTELDTLIIS 311 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 491,202,997 Number of Sequences: 1657284 Number of extensions: 9804728 Number of successful extensions: 18833 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18831 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27710252790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -