BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D10 (482 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0254 - 15377689-15378357,15378807-15379241,15380326-153803... 30 1.1 11_04_0266 - 15545781-15546266,15546620-15546814 27 7.9 >11_04_0254 - 15377689-15378357,15378807-15379241,15380326-15380370, 15380675-15381145 Length = 539 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 219 VTYVTVNNIFATQPAAP*DIIRLHPVGPSLTSHMS 115 V+ V VNN+ + +++RLHPV P L +H+S Sbjct: 377 VSEVQVNNMTYLRAVVK-EVLRLHPVAPLLATHVS 410 >11_04_0266 - 15545781-15546266,15546620-15546814 Length = 226 Score = 27.1 bits (57), Expect = 7.9 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -3 Query: 219 VTYVTVNNIFATQPAAP*DIIRLHPVGPSLTSHMS 115 V+ V +NN+ A A + IRLHPV P L H+S Sbjct: 111 VSEVDINNM-AYLRAVIKEGIRLHPVAPVLAPHIS 144 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,945,302 Number of Sequences: 37544 Number of extensions: 266945 Number of successful extensions: 527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 987904180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -