BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D07 (286 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0216 + 15804110-15804284,15804341-15804351 30 0.33 06_03_0795 - 24683023-24683155,24685853-24686057,24686275-246864... 30 0.33 03_05_0517 - 25118232-25118730,25119002-25119273 29 0.44 09_03_0184 - 13205741-13206181 28 1.0 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 28 1.3 01_05_0514 - 22876264-22878567 28 1.3 07_03_0817 - 21735283-21735358,21735719-21735796,21735885-217359... 27 1.8 09_02_0511 - 10079180-10079355,10079656-10079722,10080144-100801... 27 3.1 07_03_0866 - 22134215-22135351 27 3.1 07_03_0202 + 15131001-15131047,15131488-15131754,15131913-151319... 27 3.1 03_05_0766 - 27565477-27565995 27 3.1 03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007,692... 27 3.1 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 27 3.1 12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-10... 26 4.1 09_01_0136 - 2030523-2031062,2032349-2032534,2032642-2032796,203... 26 4.1 07_03_1160 - 24430240-24431268 26 4.1 07_01_0601 + 4464745-4465010,4465274-4466582 26 4.1 03_02_0259 - 6920472-6920579,6920744-6921022,6921115-6921390,692... 26 4.1 02_01_0138 + 999809-999821,1000456-1001341,1001424-1003221,10037... 26 4.1 12_01_1022 - 10435409-10435564,10435950-10436219,10436820-104371... 26 5.4 04_01_0072 - 784922-785567,785673-786406 26 5.4 02_04_0398 - 22598895-22599100,22599865-22599943 26 5.4 11_01_0014 + 108647-108816,109704-109803,109891-110018,110232-11... 25 7.1 10_01_0036 + 427678-428029,431043-431968 25 7.1 02_01_0406 - 2958933-2962076 25 7.1 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 25 9.4 06_01_0817 - 6185881-6187074 25 9.4 04_01_0536 - 6965343-6965537,6966407-6966595 25 9.4 03_05_0142 - 21217375-21217518,21217851-21217899,21218191-212182... 25 9.4 03_02_0721 - 10677286-10678018,10679293-10679373,10682516-106826... 25 9.4 02_01_0604 + 4497210-4497569,4497637-4497822,4498218-4498573,449... 25 9.4 >12_02_0216 + 15804110-15804284,15804341-15804351 Length = 61 Score = 29.9 bits (64), Expect = 0.33 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 68 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 190 SG P+ +H V FF+ SN SGNY + G F Sbjct: 12 SGSPAPPYKNHTVAGADGWFFNATSNTTSGNYSDWAAGETF 52 >06_03_0795 - 24683023-24683155,24685853-24686057,24686275-24686443, 24686590-24686775,24686916-24687124,24687197-24687362 Length = 355 Score = 29.9 bits (64), Expect = 0.33 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 95 HYCRPMEHHYCPPRELCLRQPW 30 HYCR +E+ YC + L R+ W Sbjct: 181 HYCRSIENWYCLSKTLAEREAW 202 >03_05_0517 - 25118232-25118730,25119002-25119273 Length = 256 Score = 29.5 bits (63), Expect = 0.44 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +2 Query: 119 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDKPS 241 D FF++ P GN T P VD P P + + + S Sbjct: 37 DWFFTRKGESPQGNISKEETAPTGVDVTDPGRPGRAFTQDS 77 >09_03_0184 - 13205741-13206181 Length = 146 Score = 28.3 bits (60), Expect = 1.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 62 PPRELCLRQPWPIRRRRKT 6 PP++ LR WPI++R KT Sbjct: 125 PPKQQKLRSEWPIKKRPKT 143 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 27.9 bits (59), Expect = 1.3 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 116 PDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDKPSRPWWEV 259 P P P GP +P GP P PK P +PWW + Sbjct: 183 PGPKPKPPKPGPKPKPKPPKPGPKPKP-KPPKPGPKPKPGPPQPWWPI 229 >01_05_0514 - 22876264-22878567 Length = 767 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 265 DINFPPRPRRFVVSL 221 D+NFPP PR F+V L Sbjct: 746 DVNFPPMPRLFMVGL 760 >07_03_0817 - 21735283-21735358,21735719-21735796,21735885-21735945, 21736038-21736069,21736144-21736221,21738046-21738213, 21738711-21738897,21740019-21740160 Length = 273 Score = 27.5 bits (58), Expect = 1.8 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 116 PDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDKPSRP 247 P PF S P G Y+PI GP V P + P R+ + RP Sbjct: 216 PVPFGGPGSVPPGGRYDPI--GPPDV----PGFEPSRFVRRPRP 253 >09_02_0511 - 10079180-10079355,10079656-10079722,10080144-10080181, 10080255-10080336 Length = 120 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 56 VVDNSGVPSDGNSDHVVIANPDPFFSQPSNG 148 +++N+G S GN ++ N PFF SNG Sbjct: 57 ILNNAGATSKGNYALILPVNEFPFFLVYSNG 87 >07_03_0866 - 22134215-22135351 Length = 378 Score = 26.6 bits (56), Expect = 3.1 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 119 DPFFSQPSNGPSGNYEPISTGPAFVDFNHP----NYPPKRYDKPSRPW 250 D +PS GP G + T A V+ + P PP Y S PW Sbjct: 223 DTTSDEPSPGPGGARPKVDTEMAHVEDDAPVLSRGTPPAPYVTESAPW 270 >07_03_0202 + 15131001-15131047,15131488-15131754,15131913-15131940, 15132120-15132179,15132570-15132696,15132907-15133724 Length = 448 Score = 26.6 bits (56), Expect = 3.1 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = +2 Query: 44 NRVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGP----SGNYEPISTGPAFVDFN 202 NR+HV+D + V I+ PDP +P + P S P + +F +FN Sbjct: 19 NRLHVLDPPCPSPVAAGEKVSISAPDPISHKPVSRPKVPVSDGNAPNAISKSFFNFN 75 >03_05_0766 - 27565477-27565995 Length = 172 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 262 INFPPRPRRFVVSLGWIIGMIEIDERRS 179 ++ PP PR + +GWI + DE S Sbjct: 120 VDLPPPPRYVYLDIGWITRKLPADEFES 147 >03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007, 6926093-6926368,6926460-6926678,6926758-6926926, 6927208-6927382,6927489-6927600,6929566-6929820 Length = 604 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 56 VVDNSGVPSDGNSDHVVIANPDPFFSQP 139 V++N +P N HVV+ANP P P Sbjct: 248 VLENCQLPH-ANHGHVVLANPSPILFYP 274 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 26.6 bits (56), Expect = 3.1 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +2 Query: 68 SGVPSD-GNSDHVVIANPDPFF-SQPSNGPSGNYEPIST 178 SG PS GN+ + ++P PF S PS+G SGNY + T Sbjct: 464 SGSPSHRGNAG--MKSSPSPFAPSGPSSGGSGNYGRLPT 500 >12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-106310, 106787-106825,107026-107109,107193-107241,107331-107422, 107680-107809,107906-107982,108058-109676,110024-110221, 110287-110825 Length = 1109 Score = 26.2 bits (55), Expect = 4.1 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = +2 Query: 122 PFFSQPSNGPSG------NYEPISTGPAFVDFNHPNYPP 220 P FS P+ P+G ++E ++ P F N PN PP Sbjct: 875 PGFSAPARVPTGFSSGFSSHEGLNPPPGFSSHNGPNPPP 913 >09_01_0136 - 2030523-2031062,2032349-2032534,2032642-2032796, 2032917-2033079 Length = 347 Score = 26.2 bits (55), Expect = 4.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 92 YCRPMEHHYCPPRELCLRQPWPIRRRR 12 YC+ E+ YC + + + W + RRR Sbjct: 163 YCKRTENWYCYAKTVAEQGAWEVARRR 189 >07_03_1160 - 24430240-24431268 Length = 342 Score = 26.2 bits (55), Expect = 4.1 Identities = 13/45 (28%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 116 PDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP-KRYDKPSRP 247 P P P P+ N P+ P +P+ PP + D P P Sbjct: 48 PPPLLPTPDVVPNPNQPPLQPTPGVPPLPNPDVPPMNKPDVPPMP 92 >07_01_0601 + 4464745-4465010,4465274-4466582 Length = 524 Score = 26.2 bits (55), Expect = 4.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 92 SDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 187 SDH V+ P PF P++ + + PI T PA Sbjct: 50 SDHFVLT-PPPFQITPTSIQNSTWLPIPTSPA 80 >03_02_0259 - 6920472-6920579,6920744-6921022,6921115-6921390, 6921473-6921691,6921795-6921963,6922248-6922422, 6922490-6922601,6923343-6923573 Length = 522 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 56 VVDNSGVPSDGNSDHVVIANPDPFFSQP 139 V++N +P N HV++ANP P P Sbjct: 240 VLENCQLPHP-NHGHVILANPSPILCYP 266 >02_01_0138 + 999809-999821,1000456-1001341,1001424-1003221, 1003716-1003805,1004034-1004111,1004513-1004518, 1004849-1004958,1005174-1005369 Length = 1058 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 91 IAVRWNTTIVHHVNSV 44 IA RW T ++HHVNS+ Sbjct: 507 IAGRWLTQMLHHVNSL 522 >12_01_1022 - 10435409-10435564,10435950-10436219,10436820-10437125, 10437932-10438057,10439825-10439893,10440443-10440487, 10440717-10440776,10441527-10441589,10442186-10442266, 10442494-10442916 Length = 532 Score = 25.8 bits (54), Expect = 5.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 89 NSDHVVIANPDPFFSQPSNGPSGNYEPIS-TGPAFVDFNHPNYPP 220 N HV P P +S P G Y P G V N P YPP Sbjct: 357 NEHHVPFIAPSPSYSAGMLPPQGMYPPPEWNGYHQVPLN-PYYPP 400 >04_01_0072 - 784922-785567,785673-786406 Length = 459 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +2 Query: 125 FFSQPSNGP--SGNYEPISTGPAFVD 196 FFS+PS GP SGN++ + +D Sbjct: 66 FFSRPSKGPTVSGNFDYLPCSSCIID 91 >02_04_0398 - 22598895-22599100,22599865-22599943 Length = 94 Score = 25.8 bits (54), Expect = 5.4 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +2 Query: 134 QPSNGPSG--NYEPISTGPAFVDFNHPNYPPKRYDKPSRPW 250 Q GP G +Y P + G +P P + +D+P RPW Sbjct: 31 QGGGGPPGYGHYPPWNGG-------YPGRPDRPWDRPDRPW 64 >11_01_0014 + 108647-108816,109704-109803,109891-110018,110232-110394, 110491-110603,111080-111118,111319-111402,111486-111534, 111624-111715,111999-112128,112225-112301,112377-113995, 114348-114545,114635-115173 Length = 1166 Score = 25.4 bits (53), Expect = 7.1 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 6/39 (15%) Frame = +2 Query: 122 PFFSQPSNGPSG------NYEPISTGPAFVDFNHPNYPP 220 P FS P+ P G ++E ++ P F N PN PP Sbjct: 932 PGFSAPARVPPGFSSGFSSHEGLNPPPGFSSHNGPNPPP 970 >10_01_0036 + 427678-428029,431043-431968 Length = 425 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 89 CRPMEHHYCPPRELCLRQPWPIRRRRKTR 3 CR Y P R++CL P R RR R Sbjct: 249 CRTAALFYAPHRQVCLYLPSNARGRRMRR 277 >02_01_0406 - 2958933-2962076 Length = 1047 Score = 25.4 bits (53), Expect = 7.1 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +2 Query: 107 IANPDP-FFSQPS-NGPSGNYEPISTGPAFVDFNHPNY 214 IA+ DP F P NGPS Y ++ P ++ +H N+ Sbjct: 528 IAHLDPGAFELPVYNGPSFQYRTLTGFPTLLNLSHNNF 565 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 25.0 bits (52), Expect = 9.4 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 116 PDPFFSQPSNGPSGNYEP----ISTGPAFVDFNHPNYPPKRYDKPSRP 247 P PF + P P G P + GP P PP+ Y +P P Sbjct: 48 PPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPP 95 >06_01_0817 - 6185881-6187074 Length = 397 Score = 25.0 bits (52), Expect = 9.4 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = +2 Query: 119 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDKPSRPWWEVNVS 268 DP S PS S E IS AFV P RY P+ W +S Sbjct: 137 DPLPSPPSPVVSALLELISALSAFVASTPPLPHNSRYGNPAFRLWHEKLS 186 >04_01_0536 - 6965343-6965537,6966407-6966595 Length = 127 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 143 NGPSGNYEPISTG 181 NGP+GNYE I G Sbjct: 102 NGPTGNYEGIGAG 114 >03_05_0142 - 21217375-21217518,21217851-21217899,21218191-21218258, 21218368-21218413,21218548-21218641,21218775-21218837, 21219018-21219171,21219414-21219476,21219568-21219681, 21219779-21219844,21220813-21220870,21221859-21221932, 21222045-21222110,21223139-21223187,21223483-21223550, 21223660-21223705,21223908-21224001,21224117-21224179, 21224290-21224412,21224503-21224536,21224906-21224968, 21225825-21225911,21226293-21226370 Length = 587 Score = 25.0 bits (52), Expect = 9.4 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +2 Query: 119 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDKPSRP 247 +PF + S G S S G + + P+ PP + P P Sbjct: 298 NPFADKASKGGSAGQSSYSGGAFYTTQSRPSAPPATHLSPLPP 340 >03_02_0721 - 10677286-10678018,10679293-10679373,10682516-10682645, 10682969-10683101 Length = 358 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 80 SDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 184 SD V+ +P+ SQP+NG SG GP Sbjct: 213 SDEARSGSVVVDPEEPSSQPNNGSSGGGGGTPDGP 247 >02_01_0604 + 4497210-4497569,4497637-4497822,4498218-4498573, 4499042-4499122,4499451-4499610,4499855-4499920 Length = 402 Score = 25.0 bits (52), Expect = 9.4 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 92 YCRPMEHHYCPPRELCLRQPWPIRRRR 12 YC+ ++ YC + + R+ W + R R Sbjct: 177 YCKNTKNWYCYAKTIAERKAWEVARGR 203 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,758,963 Number of Sequences: 37544 Number of extensions: 178245 Number of successful extensions: 510 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 14,793,348 effective HSP length: 70 effective length of database: 12,165,268 effective search space used: 291966432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -