BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D07 (286 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 25 0.72 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 1.7 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 22 3.9 AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preprop... 22 5.1 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 21 6.7 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 21 6.7 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 21 6.7 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 21 6.7 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 21 8.9 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 21 8.9 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 21 8.9 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 21 8.9 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 21 8.9 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 21 8.9 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 21 8.9 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 21 8.9 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 21 8.9 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 21 8.9 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 21 8.9 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 21 8.9 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 21 8.9 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 21 8.9 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 21 8.9 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 21 8.9 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 21 8.9 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 21 8.9 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 24.6 bits (51), Expect = 0.72 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 191 VDFNHPNYPPKRYDKPSRPWWEV 259 V+ N P + +P RPWW V Sbjct: 64 VERNPAIQPVGIFGRPGRPWWSV 86 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +2 Query: 110 ANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 220 A+PD F S P + +S ++ P +PP Sbjct: 370 AHPDHFLDHRSPSPQRGNQSLSQMTEILEAIQPEFPP 406 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 208 GMIEIDERRSSAYGFII 158 G+++ DER +SAY F + Sbjct: 680 GLMDCDERFTSAYQFAV 696 >AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preproprotein protein. Length = 193 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 208 GMIEIDERRSSAYGFIISART 146 G+ E D+ R S GF+ ART Sbjct: 118 GVDEQDQMRFSLEGFLTGART 138 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 21.4 bits (43), Expect = 6.7 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 239 SRPWWE 256 SRPWWE Sbjct: 79 SRPWWE 84 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = +1 Query: 13 LLRRIGHGCRKQSSRGGQ*WCSIG 84 L+ HGC GG C +G Sbjct: 112 LVPEYSHGCMSPEQGGGLLQCKVG 135 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +2 Query: 137 PSNGPSGNYEPISTGPAFVDFNHPNYPP 220 P N P+STG ++ H PP Sbjct: 1924 PYKATGQNDGPLSTGVTIAEYGHWVAPP 1951 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -1 Query: 70 TIVHHVNSVCGSHGQYGEEEKHE 2 +I H + +CG + +EK E Sbjct: 2732 SISHGLEQICGGSADFPSQEKAE 2754 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 Query: 116 PDPFFSQPSNGPSGNYEPI 172 P P P GP+G+ P+ Sbjct: 595 PSPLAGGPLGGPAGSRPPL 613 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 194 DFNHPNYPPKRYD 232 DF+ P PP R+D Sbjct: 399 DFDIPALPPSRFD 411 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 21.0 bits (42), Expect = 8.9 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 68 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 184 S + +D N +V D Q N P+ + PIS+ P Sbjct: 102 STLGADSNFGSLVNGAVDTCARQIQNDPAYSVAPISSSP 140 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -1 Query: 61 HHVNSVCGSHGQYGEEEKH 5 HHV+ + HG Y + H Sbjct: 42 HHVHMMPEMHGAYSQVHHH 60 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -1 Query: 61 HHVNSVCGSHGQYGEEEKH 5 HHV+ + HG Y + H Sbjct: 42 HHVHMMPEMHGAYSQVHHH 60 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 196 HYAAPIAHHAAP 207 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 232 HYAAPIAHHAAP 243 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 95 HYCRPMEHHYCP 60 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 326,391 Number of Sequences: 2352 Number of extensions: 7208 Number of successful extensions: 39 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 16950141 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -